Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63060 71 / 1e-17 unknown protein AT5G07330 52 / 5e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001796 [exp] 141 / 6e-46 AT1G63060 87 / 2e-23 unknown protein Lus10002567 [exp] 140 / 2e-45 AT1G63060 89 / 3e-24 unknown protein Lus10018040 [exp] 61 / 2e-13 AT5G07330 117 / 1e-33 unknown protein Lus10042036 [exp] 59 / 1e-12 AT5G07330 118 / 3e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G160700 [exp] 81 / 4e-21 AT1G63060 114 / 4e-33 unknown protein Potri.015G109100 [exp] 61 / 2e-13 AT5G07330 133 / 3e-40 unknown protein Potri.012G111000 [exp] 59 / 1e-12 AT5G07330 130 / 4e-39 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000001 pacid=23178686 polypeptide=Lus10000001 locus=Lus10000001.g ID=Lus10000001.BGIv1.0 annot-version=v1.0 ATGGGCTTTGTGACGTTGGCGGCAGGTATAGGGATCCACTCAGTAAAACAACAGCTATTACACTCCCCAGGAGTGAGTCTGAAGAAGACGAGGAGAGGAT CGATGTCAGAGGCTGATAACCCGGATCTTGCAACTACTAACGCACAAAACTTTCTCAACAAATCCTTCCTCCGTAAAATTGCTCGCATCCAACAGCAACA AGACAAGAATTAA
AA sequence Show only first row Show all	>Lus10000001 pacid=23178686 polypeptide=Lus10000001 locus=Lus10000001.g ID=Lus10000001.BGIv1.0 annot-version=v1.0 MGFVTLAAGIGIHSVKQQLLHSPGVSLKKTRRGSMSEADNPDLATTNAQNFLNKSFLRKIARIQQQQDKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G63060			unknown protein		Lus10000001 [exp]	0	1
AT5G26150			protein kinase family protein ...		Lus10000068 [exp]	8.2
AT5G35110			unknown protein		Lus10000078 [exp]	8.8
AT2G38540		ATLTP1, LP1	ARABIDOPSIS THALIANA LIPID TRA...		Lus10000082 [exp]	9.0
AT2G46490			unknown protein		Lus10000088 [exp]	9.3
AT4G09160			SEC14 cytosolic factor family ...		Lus10000102 [exp]	10.0
AT1G60780		HAP13	HAPLESS 13, Clathrin adaptor c...		Lus10000107 [exp]	10.3
					Lus10000109 [exp]	10.4
AT3G07565			Protein of unknown function (D...		Lus10000123 [exp]	11.0
					Lus10000134 [exp]	11.5
AT5G17490	GRAS	AtRGL3, RGL3	RGA-like protein 3 (.1)		Lus10000140 [exp]	11.8

Compare expression of checked genes

Lus10000001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.