Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75330 85 / 2e-21 OTC ornithine carbamoyltransferase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010641 [exp] 89 / 1e-22 AT1G75330 547 / 0.0 ornithine carbamoyltransferase (.1) Lus10033203 [exp] 88 / 1e-22 AT1G75330 546 / 0.0 ornithine carbamoyltransferase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G229400 [exp] 85 / 3e-21 AT1G75330 561 / 0.0 ornithine carbamoyltransferase (.1) Potri.002G033701 [exp] 62 / 6e-15 AT1G75330 74 / 3e-17 ornithine carbamoyltransferase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02729 [flax] [poplar] OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Representative CDS sequence Show only first row Show all	>Lus10000002 pacid=23158591 polypeptide=Lus10000002 locus=Lus10000002.g ID=Lus10000002.BGIv1.0 annot-version=v1.0 ATGGATCTAGCAAAATATGCAGCTGTACCTGTTATCAATGGCCTAACTGATTACAATCATCCTTGCCAAATAATGGCCGACGCCCTGACTATGATTGAAC ACATCGGTCAATTGGAAGGAACTAAGGTGCGTCCAGCAACTGTTCGTTTTAGCTTCTTGCACGATCTATCAGCAGGATCTTTTCCTAAACCTTAA
AA sequence Show only first row Show all	>Lus10000002 pacid=23158591 polypeptide=Lus10000002 locus=Lus10000002.g ID=Lus10000002.BGIv1.0 annot-version=v1.0 MDLAKYAAVPVINGLTDYNHPCQIMADALTMIEHIGQLEGTKVRPATVRFSFLHDLSAGSFPKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75330		OTC	ornithine carbamoyltransferase...		Lus10000002 [exp]	0	1
AT3G25890	AP2_ERF	CRF11	cytokinin response factor 11, ...		Lus10035018 [exp]	5.6	0.8527
AT2G35540			DNAJ heat shock N-terminal dom...		Lus10027316 [exp]	11.8	0.8438
AT4G11420		ATTIF3A1, ATEIF...	eukaryotic translation initiat...		Lus10031477 [exp]	17.0	0.8460
AT3G25890	AP2_ERF	CRF11	cytokinin response factor 11, ...		Lus10021678 [exp]	17.0	0.8455
AT2G05920			Subtilase family protein (.1)		Lus10033431 [exp]	19.9	0.8320
AT5G41270			unknown protein		Lus10030018 [exp]	21.8	0.8179
AT1G69170	SBP	SPL6	Squamosa promoter-binding prot...		Lus10021141 [exp]	29.5	0.7909
AT3G15140			Polynucleotidyl transferase, r...		Lus10009194 [exp]	33.0	0.8276
AT5G38830			Cysteinyl-tRNA synthetase, cla...		Lus10010336 [exp]	33.7	0.7935
AT2G30580		BMI1A, DRIP2	DREB2A-interacting protein 2 (...		Lus10033860 [exp]	37.9	0.8134

Compare expression of checked genes

Lus10000002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.