Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24380 122 / 4e-37 unknown protein AT5G65400 78 / 4e-19 alpha/beta-Hydrolases superfamily protein (.1) AT1G09280 38 / 0.0003 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020946 [exp] 167 / 8e-54 AT4G24380 327 / 1e-114 unknown protein Lus10008722 [exp] 162 / 6e-52 AT4G24380 320 / 7e-112 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G102500 [exp] 126 / 4e-38 AT4G24380 334 / 1e-117 unknown protein Potri.006G027000 [exp] 82 / 1e-20 AT4G24380 211 / 4e-68 unknown protein Potri.005G011300 [exp] 43 / 4e-06 AT1G09280 773 / 0.0 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF03959 [flax] [poplar] FSH1 Serine hydrolase (FSH1)
Representative CDS sequence Show only first row Show all	>Lus10000004 pacid=23160127 polypeptide=Lus10000004 locus=Lus10000004.g ID=Lus10000004.BGIv1.0 annot-version=v1.0 ATGGGGTCGGAAGGCGAGATGCCGCCGGTGGGGAGGAAACCAAGGTTTCTATGCTTACACGGGTTCAGAACCAGCGCAGAAATCCTAAAGAAGCAGCTCA ACACGAAATGGCCCGAATCTGTTATCCAGAAGCTGGACCTCGTCTACGTAGACGCCCCTCATCCCTCGGAGGGAAAATCTGAGGTCGAAGGCATATTTGA TCCTCCTTATTACGAGTGGTTCCAGTTCAACAAGGTCCGCTTTCCCCTGAATCTCATTTCTCCTTATTAG
AA sequence Show only first row Show all	>Lus10000004 pacid=23160127 polypeptide=Lus10000004 locus=Lus10000004.g ID=Lus10000004.BGIv1.0 annot-version=v1.0 MGSEGEMPPVGRKPRFLCLHGFRTSAEILKKQLNTKWPESVIQKLDLVYVDAPHPSEGKSEVEGIFDPPYYEWFQFNKVRFPLNLISPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G24380			unknown protein		Lus10000004 [exp]	0	1
AT4G24380			unknown protein		Lus10020946 [exp]	1.0	0.8673
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10010476 [exp]	17.7	0.7521
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10016598 [exp]	24.4	0.6730
AT5G54855			Pollen Ole e 1 allergen and ex...		Lus10019622 [exp]	41.0	0.6872
					Lus10016602 [exp]	41.1	0.7236
					Lus10016819 [exp]	46.6	0.7091
AT5G51040			unknown protein		Lus10032526 [exp]	49.5	0.7106
AT5G17680			disease resistance protein (TI...		Lus10010223 [exp]	51.6	0.6979
AT1G13510			Protein of unknown function (D...		Lus10031915 [exp]	60.6	0.6368
AT3G55740		ATPROT2, ProT2	proline transporter 2 (.1.2)		Lus10028251 [exp]	93.0	0.6885

Compare expression of checked genes

Lus10000004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.