Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31500 119 / 5e-34 DNAse I-like superfamily protein (.1.2.3.4) AT1G31530 72 / 2e-16 DNAse I-like superfamily protein (.1) AT3G18500 42 / 1e-05 DNAse I-like superfamily protein (.1.2.3) AT1G73875 38 / 0.0004 DNAse I-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000006 [exp] 191 / 5e-65 AT1G31500 122 / 1e-35 DNAse I-like superfamily protein (.1.2.3.4) Lus10026203 [exp] 160 / 2e-49 AT1G31500 458 / 2e-162 DNAse I-like superfamily protein (.1.2.3.4) Lus10042463 [exp] 100 / 3e-27 AT1G31500 206 / 3e-64 DNAse I-like superfamily protein (.1.2.3.4) Lus10014775 [exp] 49 / 9e-08 AT3G18500 423 / 7e-146 DNAse I-like superfamily protein (.1.2.3) Lus10036357 [exp] 46 / 6e-07 AT3G18500 422 / 2e-145 DNAse I-like superfamily protein (.1.2.3) Lus10013119 [exp] 44 / 4e-06 AT5G11350 536 / 0.0 DNAse I-like superfamily protein (.1) Lus10008086 [exp] 44 / 5e-06 AT5G11350 526 / 9e-178 DNAse I-like superfamily protein (.1) Lus10032490 [exp] 39 / 0.0002 AT1G73875 446 / 3e-154 DNAse I-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G106000 [exp] 119 / 2e-33 AT1G31500 457 / 1e-160 DNAse I-like superfamily protein (.1.2.3.4) Potri.018G032300 [exp] 47 / 3e-07 AT5G11350 560 / 0.0 DNAse I-like superfamily protein (.1) Potri.012G057100 [exp] 39 / 0.0003 AT1G73875 502 / 2e-176 DNAse I-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0530 [flax] [poplar] DNase_I-like PF03372 [flax] [poplar] Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Representative CDS sequence Show only first row Show all	>Lus10000005 pacid=23175333 polypeptide=Lus10000005 locus=Lus10000005.g ID=Lus10000005.BGIv1.0 annot-version=v1.0 ATGGCTGCTTTTAAACTCAAAGGTCCCTTCTACAACACTGTTATAGTGGCAAATACACATCTTTACTGGGATCCAGAGTGGGCAGATGTGAAGCTTGCAC AGGCAAGGTATCTTCTTTCCCGGCTGGCGAAGTTTAAGATGCTGGTTTCTGAAATGTTTGAATGTGAACCTTCAGTAGTCCTGACTGGTGACTTCAATTC AACCCCTGGAGACAAGGTTTGTGTTTCCCAAACAAAAGATGAGCTGTGGAAAGGCAAAAATGAAACCTTTGGCGTGCATTTCCTTTATGCCTTTTTCTGA
AA sequence Show only first row Show all	>Lus10000005 pacid=23175333 polypeptide=Lus10000005 locus=Lus10000005.g ID=Lus10000005.BGIv1.0 annot-version=v1.0 MAAFKLKGPFYNTVIVANTHLYWDPEWADVKLAQARYLLSRLAKFKMLVSEMFECEPSVVLTGDFNSTPGDKVCVSQTKDELWKGKNETFGVHFLYAFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31500			DNAse I-like superfamily prote...		Lus10000005 [exp]	0	1
AT3G15620		UVR3	UV REPAIR DEFECTIVE 3, DNA pho...		Lus10000521 [exp]	8.9	0.6219
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10032438 [exp]	9.9	0.5631
AT3G49030			FBD, F-box and Leucine Rich Re...		Lus10029424 [exp]	10.4	0.5887
AT3G26000			Ribonuclease inhibitor (.1)		Lus10011378 [exp]	34.4	0.5942
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10027028 [exp]	39.2	0.5556
					Lus10033149 [exp]	40.4	0.5556
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10006200 [exp]	41.6	0.5556
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	42.7	0.5556
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10019334 [exp]	43.8	0.5556
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020441 [exp]	44.9	0.5556

Compare expression of checked genes

Lus10000005 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.