Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31500 124 / 1e-35 DNAse I-like superfamily protein (.1.2.3.4) AT1G31530 71 / 3e-16 DNAse I-like superfamily protein (.1) AT3G18500 45 / 2e-06 DNAse I-like superfamily protein (.1.2.3) AT1G73875 38 / 0.0005 DNAse I-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000005 [exp] 191 / 5e-65 AT1G31500 118 / 5e-34 DNAse I-like superfamily protein (.1.2.3.4) Lus10026203 [exp] 152 / 3e-46 AT1G31500 458 / 2e-162 DNAse I-like superfamily protein (.1.2.3.4) Lus10042463 [exp] 105 / 7e-29 AT1G31500 206 / 3e-64 DNAse I-like superfamily protein (.1.2.3.4) Lus10014775 [exp] 52 / 7e-09 AT3G18500 423 / 7e-146 DNAse I-like superfamily protein (.1.2.3) Lus10036357 [exp] 49 / 4e-08 AT3G18500 422 / 2e-145 DNAse I-like superfamily protein (.1.2.3) Lus10032490 [exp] 42 / 1e-05 AT1G73875 446 / 3e-154 DNAse I-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G106000 [exp] 122 / 1e-34 AT1G31500 457 / 1e-160 DNAse I-like superfamily protein (.1.2.3.4) Potri.018G032300 [exp] 46 / 6e-07 AT5G11350 560 / 0.0 DNAse I-like superfamily protein (.1) Potri.012G057100 [exp] 40 / 5e-05 AT1G73875 502 / 2e-176 DNAse I-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0530 [flax] [poplar] DNase_I-like PF03372 [flax] [poplar] Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Representative CDS sequence Show only first row Show all	>Lus10000006 pacid=23158765 polypeptide=Lus10000006 locus=Lus10000006.g ID=Lus10000006.BGIv1.0 annot-version=v1.0 ATGGCTGCTTTTAAACTCAAAGGTCCCTTCTACAACATTGTTATAGTGGCAAATACACATCTTTACTGGGATCCAGAGTGGGCAGATGTGAAGCTTGCAC AAGCAAAGTATCTTCTTTCCCGGCTGGCGAAGTTTAAGATCCTGGTTTCTGAAAAGTTTGAATGTGAACCTTCAGTAATCCTGACTGGTGACTTCAATTC AACCCCTGGAGACAAGGTTTGTGTTTTCCAAACAAAAGATGAGCTGTGGAAAGACAAAAATGAAACCTTTGGCGTGCATTTCCTTCATGCCTTGTTCTGA
AA sequence Show only first row Show all	>Lus10000006 pacid=23158765 polypeptide=Lus10000006 locus=Lus10000006.g ID=Lus10000006.BGIv1.0 annot-version=v1.0 MAAFKLKGPFYNIVIVANTHLYWDPEWADVKLAQAKYLLSRLAKFKILVSEKFECEPSVILTGDFNSTPGDKVCVFQTKDELWKDKNETFGVHFLHALF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31500			DNAse I-like superfamily prote...		Lus10000006 [exp]	0	1
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10022111 [exp]	4.7	0.7935
AT3G09500			Ribosomal L29 family protein ...		Lus10030314 [exp]	13.0	0.6944
AT4G30580		LPAT1, ATS2, EM...	lysophosphatidic acid acyltran...		Lus10022158 [exp]	13.7	0.7711
AT1G75010		ARC3	ACCUMULATION AND REPLICATION O...		Lus10000187 [exp]	18.4	0.7837
AT5G66550			Maf-like protein (.1)		Lus10040204 [exp]	25.1	0.7527
AT4G03080		BSL1	BRI1 suppressor 1 (BSU1)-like ...		Lus10024772 [exp]	32.7	0.6843
AT1G76405			unknown protein		Lus10025160 [exp]	33.0	0.7511
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	35.1	0.7419
AT5G07940			unknown protein		Lus10034693 [exp]	49.4	0.7398
AT1G69630			F-box/RNI-like superfamily pro...		Lus10008245 [exp]	50.0	0.7219

Compare expression of checked genes

Lus10000006 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.