Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11840 127 / 4e-38 ATGLX1 glyoxalase I homolog (.1.2.3.4.5.6) AT1G67280 120 / 4e-34 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002943 [exp] 145 / 1e-44 AT1G11840 447 / 5e-160 glyoxalase I homolog (.1.2.3.4.5.6) Lus10003523 [exp] 145 / 2e-42 AT1G11840 495 / 5e-174 glyoxalase I homolog (.1.2.3.4.5.6) Lus10011115 [exp] 121 / 2e-34 AT1G67280 543 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2) Lus10043235 [exp] 121 / 2e-34 AT1G67280 551 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2) Lus10038612 [exp] 115 / 3e-32 AT1G67280 455 / 4e-161 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2) Lus10016138 [exp] 39 / 0.0003 AT1G08110 302 / 2e-104 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4) Lus10021429 [exp] 38 / 0.0005 AT1G08110 297 / 3e-104 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G013200 [exp] 135 / 2e-40 AT1G11840 496 / 8e-179 glyoxalase I homolog (.1.2.3.4.5.6) Potri.018G084800 [exp] 124 / 1e-35 AT1G67280 553 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2) Potri.006G160600 [exp] 124 / 2e-35 AT1G67280 571 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2) Potri.018G042100 [exp] 117 / 8e-33 AT1G67280 488 / 3e-174 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2) Potri.006G239802 [exp] 91 / 2e-25 AT1G67280 90 / 7e-13 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2) Potri.009G007200 [exp] 39 / 0.0001 AT1G08110 318 / 6e-111 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0104 [flax] [poplar] Glyoxalase PF00903 [flax] [poplar] Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10000007 pacid=23177876 polypeptide=Lus10000007 locus=Lus10000007.g ID=Lus10000007.BGIv1.0 annot-version=v1.0 ATGGCTGAAGCTGCAGCTGTCGCTACTCCTAGCGCTGAATTGTTGGAATTCCCCAAGAAGGACAAGCGTCGGATCCTCCACGCCGTCTATCGCGTTGGCG ATCTTGATCGGACCATTCAGTTCTACACTGAAGGTCTGGGGATGAAGCTGCTTAGGAAGAGAGACATTCCAGAGGAGAAATACTCTAATGCTTTCCTTGG TTTTGGTCCTGAGGATTCAAATTTCGTCGTCGAGCTGACTTACAGTACTATTGTTTCCTATCCTTCCTCTGAAACTAATAAATCCCATCCCTTTCGTTGC CCATTTTGCTAA
AA sequence Show only first row Show all	>Lus10000007 pacid=23177876 polypeptide=Lus10000007 locus=Lus10000007.g ID=Lus10000007.BGIv1.0 annot-version=v1.0 MAEAAAVATPSAELLEFPKKDKRRILHAVYRVGDLDRTIQFYTEGLGMKLLRKRDIPEEKYSNAFLGFGPEDSNFVVELTYSTIVSYPSSETNKSHPFRC PFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11840		ATGLX1	glyoxalase I homolog (.1.2.3.4...		Lus10000007 [exp]	0	1
AT5G62440			Protein of unknown function (D...		Lus10023594 [exp]	2.4	0.8386
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10037758 [exp]	8.4	0.7728
AT5G22280			unknown protein		Lus10034182 [exp]	8.8	0.7748
AT3G48680		AtCAL2, GAMMACA...	gamma carbonic anhydrase-like ...		Lus10031847 [exp]	8.9	0.8362
AT3G07720			Galactose oxidase/kelch repeat...		Lus10012345 [exp]	11.8	0.8038
AT3G14240			Subtilase family protein (.1)		Lus10034517 [exp]	12.1	0.8150
AT2G32070			Polynucleotidyl transferase, r...		Lus10003635 [exp]	13.6	0.8004
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Lus10037520 [exp]	17.7	0.8142
AT1G13410			Tetratricopeptide repeat (TPR)...		Lus10021069 [exp]	17.9	0.7895
AT4G03965			RING/U-box superfamily protein...		Lus10029993 [exp]	18.7	0.7937

Compare expression of checked genes

Lus10000007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.