Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14830 58 / 1e-11 HSP1 heat shock protein 20-like protein 1, unknown protein AT3G22530 57 / 6e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035239 [exp] 189 / 5e-64 AT3G22530 59 / 6e-14 unknown protein Lus10004901 [exp] 77 / 2e-18 AT3G22530 167 / 9e-52 unknown protein Lus10010549 [exp] 0 / 1 AT3G22530 164 / 1e-51 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G086400 [exp] 76 / 5e-18 AT3G22530 165 / 3e-51 unknown protein Potri.008G154100 [exp] 68 / 2e-15 AT3G22530 140 / 2e-42 unknown protein Potri.002G051100 [exp] 53 / 1e-09 AT3G22530 127 / 3e-37 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000009 pacid=23182145 polypeptide=Lus10000009 locus=Lus10000009.g ID=Lus10000009.BGIv1.0 annot-version=v1.0 ATGAAGTTTCATCCAATGCCCAAAAGGAGGAACAACGTCAAAATCCAGTACTATGTAGACCACGGTGGCGTCAACAATCAGAGAGGAGACAGTGGCGGAG AGTTGTCCTCCTCCGGCGGCGACGGAAACAAGAAGCTGAGAAGGCTGCCCCAAATCTTCAATCGAGTGCGGGAACTACCGTTCCGGTCGATGCTGACGTA CGTGCCGGTGGAGGAAAGCACTGATTGCTTCCGGTTCGTGGCGGAGGCACACTATCGAAACCCATCCCGGGGTTACCAAAATCGTGATTCGACCCAACGG GTACTTCGAATTGCCGTCGTTGGATGA
AA sequence Show only first row Show all	>Lus10000009 pacid=23182145 polypeptide=Lus10000009 locus=Lus10000009.g ID=Lus10000009.BGIv1.0 annot-version=v1.0 MKFHPMPKRRNNVKIQYYVDHGGVNNQRGDSGGELSSSGGDGNKKLRRLPQIFNRVRELPFRSMLTYVPVEESTDCFRFVAEAHYRNPSRGYQNRDSTQR VLRIAVVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22530			unknown protein		Lus10000009 [exp]	0	1
AT3G22530			unknown protein		Lus10035239 [exp]	1.4	0.7979
					Lus10010597 [exp]	3.0	0.8064
AT2G26150	HSF	ATHSFA2	heat shock transcription facto...		Lus10027627 [exp]	5.0	0.7765
AT4G37300		MEE59	maternal effect embryo arrest ...		Lus10018201 [exp]	5.2	0.7970
AT1G54130		AT-RSH3, RSH3, ...	RELA/SPOT homolog 3 (.1)		Lus10008755 [exp]	5.3	0.7876
AT3G62930			Thioredoxin superfamily protei...		Lus10029441 [exp]	8.5	0.7613
AT2G28840		XBAT31	XB3 ortholog 1 in Arabidopsis ...		Lus10040829 [exp]	11.8	0.7679
AT1G06510			unknown protein		Lus10031459 [exp]	12.0	0.7648
AT3G62930			Thioredoxin superfamily protei...		Lus10029440 [exp]	13.4	0.7166
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	14.7	0.7717

Compare expression of checked genes

Lus10000009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.