Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16650 46 / 1e-07 Chaperone DnaJ-domain superfamily protein (.1) AT2G33735 44 / 4e-07 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014901 [exp] 119 / 1e-36 AT2G33735 85 / 2e-22 Chaperone DnaJ-domain superfamily protein (.1) Lus10040535 [exp] 119 / 5e-36 AT2G33735 84 / 1e-21 Chaperone DnaJ-domain superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G103900 [exp] 72 / 1e-17 AT2G33735 147 / 2e-46 Chaperone DnaJ-domain superfamily protein (.1) Potri.019G041400 [exp] 46 / 7e-08 AT5G16650 193 / 5e-65 Chaperone DnaJ-domain superfamily protein (.1) Potri.013G078200 [exp] 43 / 1e-06 AT5G16650 198 / 6e-67 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10000010 pacid=23155033 polypeptide=Lus10000010 locus=Lus10000010.g ID=Lus10000010.BGIv1.0 annot-version=v1.0 ATGATGACTTTGGATGATTTCAACGATCCTCAATCTTCTTCTCATCACCCTAACCACCAGGACGCTTACCTCAATTTCGATTTCTTCTCTCTCGTTTCCA ACCCTAAGGATTACTACAAGCTTCTGGAAGTCGACTACGATGCTTCTGATGATGCTATTCGCTCCAATTACATCCGCCTCGCTCTGGTTCCCCTCCTCAC CCACAAACTACTTCATTTTTGCCTCGATTATCACTAG
AA sequence Show only first row Show all	>Lus10000010 pacid=23155033 polypeptide=Lus10000010 locus=Lus10000010.g ID=Lus10000010.BGIv1.0 annot-version=v1.0 MMTLDDFNDPQSSSHHPNHQDAYLNFDFFSLVSNPKDYYKLLEVDYDASDDAIRSNYIRLALVPLLTHKLLHFCLDYH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16650			Chaperone DnaJ-domain superfam...		Lus10000010 [exp]	0	1
AT1G13570			F-box/RNI-like superfamily pro...		Lus10040760 [exp]	2.6	0.8481
AT4G25180			RNA polymerase III RPC4 (.1)		Lus10009019 [exp]	8.2	0.8311
AT1G06060			LisH and RanBPM domains contai...		Lus10005633 [exp]	10.5	0.8191
AT4G27680			P-loop containing nucleoside t...		Lus10008835 [exp]	11.8	0.8220
AT1G50370		AtFYPP1	flower- specific, phytochrome-...		Lus10041015 [exp]	12.0	0.8195
AT2G33735			Chaperone DnaJ-domain superfam...		Lus10014901 [exp]	22.5	0.8185
AT5G12230		MED19A	unknown protein		Lus10002150 [exp]	24.5	0.8420
AT5G58003		CPL4	C-terminal domain phosphatase-...		Lus10036689 [exp]	26.9	0.8292
AT1G11880			transferases, transferring hex...		Lus10000535 [exp]	42.4	0.7904
AT2G27285			Coiled-coil domain-containing ...		Lus10038787 [exp]	42.4	0.7977

Compare expression of checked genes

Lus10000010 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.