Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54540 171 / 2e-51 ABCF4, ATGCN4 ATP-binding cassette F4, general control non-repressible 4 (.1) AT1G64550 82 / 1e-19 SCORD5, AtGCN20, AtABCF3, ABCF3, ATGCN3 susceptible to coronatine-deficient Pst DC3000 5, general control non-repressible 20, ATP-binding cassette F3, general control non-repressible 3 (.1) AT5G60790 79 / 2e-18 ABCF1, ATGCN1 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 1, ATP-binding cassette F1, ABC transporter family protein (.1) AT5G64840 56 / 1e-10 ABCF5, ATGCN5 ATP-binding cassette F5, general control non-repressible 5 (.1) AT5G09930 54 / 7e-10 ABCF2, ATGCN2 ATP-binding cassette F2, ABC transporter family protein (.1) AT2G36910 38 / 0.0004 ATMDR1, ATPGP1, PGP1, ABCB1 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1) AT3G28860 37 / 0.001 ABCB19, ATMDR11, ATMDR1, PGP19, MDR11, MDR1, ATPGP19, ATABCB19 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016184 [exp] 184 / 3e-56 AT3G54540 1141 / 0.0 ATP-binding cassette F4, general control non-repressible 4 (.1) Lus10029363 [exp] 182 / 2e-55 AT3G54540 1139 / 0.0 ATP-binding cassette F4, general control non-repressible 4 (.1) Lus10028810 [exp] 84 / 2e-20 AT5G60790 1013 / 0.0 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 1, ATP-binding cassette F1, ABC transporter family protein (.1) Lus10038681 [exp] 82 / 2e-19 AT5G60790 1021 / 0.0 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 1, ATP-binding cassette F1, ABC transporter family protein (.1) Lus10037947 [exp] 79 / 1e-18 AT5G60790 990 / 0.0 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 1, ATP-binding cassette F1, ABC transporter family protein (.1) Lus10032431 [exp] 78 / 3e-18 AT1G64550 1244 / 0.0 susceptible to coronatine-deficient Pst DC3000 5, general control non-repressible 20, ATP-binding cassette F3, general control non-repressible 3 (.1) Lus10023043 [exp] 78 / 3e-18 AT1G64550 1249 / 0.0 susceptible to coronatine-deficient Pst DC3000 5, general control non-repressible 20, ATP-binding cassette F3, general control non-repressible 3 (.1) Lus10006804 [exp] 55 / 4e-10 AT5G64840 1050 / 0.0 ATP-binding cassette F5, general control non-repressible 5 (.1) Lus10005798 [exp] 55 / 5e-10 AT5G64840 1049 / 0.0 ATP-binding cassette F5, general control non-repressible 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G254400 [exp] 173 / 3e-52 AT3G54540 1049 / 0.0 ATP-binding cassette F4, general control non-repressible 4 (.1) Potri.008G003300 [exp] 171 / 2e-51 AT3G54540 1060 / 0.0 ATP-binding cassette F4, general control non-repressible 4 (.1) Potri.004G214300 [exp] 85 / 8e-21 AT5G60790 944 / 0.0 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 1, ATP-binding cassette F1, ABC transporter family protein (.1) Potri.009G007800 [exp] 82 / 7e-20 AT5G60790 955 / 0.0 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 1, ATP-binding cassette F1, ABC transporter family protein (.1) Potri.001G087300 [exp] 80 / 6e-19 AT1G64550 1145 / 0.0 susceptible to coronatine-deficient Pst DC3000 5, general control non-repressible 20, ATP-binding cassette F3, general control non-repressible 3 (.1) Potri.005G084800 [exp] 57 / 8e-11 AT5G64840 983 / 0.0 ATP-binding cassette F5, general control non-repressible 5 (.1) Potri.007G080600 [exp] 55 / 3e-10 AT5G64840 936 / 0.0 ATP-binding cassette F5, general control non-repressible 5 (.1) Potri.016G015550 [exp] 47 / 1e-08 AT3G54540 49 / 2e-08 ATP-binding cassette F4, general control non-repressible 4 (.1) Potri.016G093600 [exp] 38 / 0.0003 AT2G36910 2120 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1) Potri.006G123900 [exp] 38 / 0.0004 AT2G36910 2138 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000013 pacid=23159578 polypeptide=Lus10000013 locus=Lus10000013.g ID=Lus10000013.BGIv1.0 annot-version=v1.0 ATGTCAAAACCTCACATTTTGTTGCTGGATGAGCCCACCAACCATCTGGACATGCAGAGCATCGACGCGCTGGCTGATGCACTTGATGAATTCACCGGAG GAGTTGTTTTGGTTAGTCACGACTCGAGGCTGATCTCGAGGGTGTGCGAGGATGAAGAGAAGAGTTTGATCTGGGTTGTGGAAGATGGAACCGTCAACGT CTTCCCCGGGACGTTTGATGAGTACAAGGAGGAACTACAAAGAGAGATCAGAGCTGAGGTTGATGATTGA
AA sequence Show only first row Show all	>Lus10000013 pacid=23159578 polypeptide=Lus10000013 locus=Lus10000013.g ID=Lus10000013.BGIv1.0 annot-version=v1.0 MSKPHILLLDEPTNHLDMQSIDALADALDEFTGGVVLVSHDSRLISRVCEDEEKSLIWVVEDGTVNVFPGTFDEYKEELQREIRAEVDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G54540		ABCF4, ATGCN4	ATP-binding cassette F4, gener...		Lus10000013 [exp]	0	1
AT3G58840		PMD1	peroxisomal and mitochondrial ...		Lus10010937 [exp]	6.3	0.8159
AT5G35732			unknown protein		Lus10006404 [exp]	7.6	0.8209
AT5G23680			Sterile alpha motif (SAM) doma...		Lus10016718 [exp]	10.7	0.7792
AT3G21740		APO4	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10039659 [exp]	11.8	0.8158
AT1G19910		AVA-2PE, ATVHA-...	VACUOLAR-TYPE H+ ATPASE C2, AT...		Lus10028370 [exp]	12.0	0.8158
AT4G18372			Small nuclear ribonucleoprotei...		Lus10000241 [exp]	18.5	0.7586
AT1G07380			Neutral/alkaline non-lysosomal...		Lus10001198 [exp]	19.6	0.7508
AT2G23780			RING/U-box superfamily protein...		Lus10022492 [exp]	20.2	0.7928
AT4G25670			unknown protein		Lus10038842 [exp]	21.6	0.7889
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10035359 [exp]	21.9	0.8087

Compare expression of checked genes

Lus10000013 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.