Lus10000015 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09060 67 / 3e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G11690 62 / 1e-11 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G53700 59 / 2e-10 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G53330 58 / 3e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G43820 58 / 3e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G02420 57 / 5e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 57 / 7e-10 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G06580 57 / 1e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G64320 56 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G04760 56 / 2e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002951 307 / 2e-104 AT5G61990 80 / 7e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10003515 296 / 3e-100 AT3G62470 80 / 6e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10015741 67 / 3e-13 AT3G62470 725 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040633 66 / 6e-13 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012037 66 / 7e-13 AT2G15630 677 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10003461 62 / 1e-11 AT3G62470 718 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021991 61 / 5e-11 AT5G15010 617 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10034419 61 / 7e-11 AT1G73400 684 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042452 60 / 7e-11 AT1G53330 442 / 1e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G075900 109 / 2e-28 AT1G05670 89 / 2e-18 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.001G236800 71 / 1e-14 AT5G59900 1071 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G069600 64 / 3e-12 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G109500 62 / 1e-11 AT1G09900 855 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G014500 62 / 2e-11 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.004G147700 62 / 2e-11 AT2G15630 736 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G090400 57 / 6e-10 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G271400 57 / 6e-10 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271200 57 / 8e-10 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.019G019300 57 / 8e-10 AT3G04760 776 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10000015 pacid=23156259 polypeptide=Lus10000015 locus=Lus10000015.g ID=Lus10000015.BGIv1.0 annot-version=v1.0
ATGCTGAGTGATGTAGGTGGGAGGGTTTACCTTACTGGTGTTCAATCCTTGGTCGAATTGCTTGCGAATTTGGTCTCGTTCAAAATGGCAAAGTTCGTGA
TTGGTTTATCGGACAAGAGAGTGTCTTATCACAGTGTATTGATCAAGGAAATGTGCAAGAAGCACGAGTTTGAACAAGCGATGAAGGAAATCGACGAGAT
GAAGGGATTCTACGGGGATGCATGCAATCCCAATTGTCGAAGCATTTACAATTACATGATCAGCACGATGCTCAAGGCCGGCAAGGAAGATGCTTCTGTG
GAAGTTCTGCATGAGATGACGAGGAAAGGGCTTCCTCCGGATGCGTTGACTTTCGAGATACTTATATGCAATTCCGTGGCGAAGAAGGAGTTCGGGACTG
TGATTAAGTTCTTTGACTCGATGGTGGAGGCCGGGGTTGAGCCCAGGAGGTCGACTCACACCACGTTGTTGAAGGTTTCTTTGACTTGGGGCAGAACGAG
GAAGCTTATAGCTATGCGGTTGCTGTGA
AA sequence
>Lus10000015 pacid=23156259 polypeptide=Lus10000015 locus=Lus10000015.g ID=Lus10000015.BGIv1.0 annot-version=v1.0
MLSDVGGRVYLTGVQSLVELLANLVSFKMAKFVIGLSDKRVSYHSVLIKEMCKKHEFEQAMKEIDEMKGFYGDACNPNCRSIYNYMISTMLKAGKEDASV
EVLHEMTRKGLPPDALTFEILICNSVAKKEFGTVIKFFDSMVEAGVEPRRSTHTTLLKVSLTWGRTRKLIAMRLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09060 Pentatricopeptide repeat (PPR)... Lus10000015 0 1
AT3G62470 Pentatricopeptide repeat (PPR)... Lus10003515 13.7 0.7276
AT1G62400 HT1 high leaf temperature 1, Prote... Lus10020018 14.2 0.7679
AT1G31830 Amino acid permease family pro... Lus10007593 14.7 0.7314
Lus10032581 17.5 0.7283
AT5G56440 F-box/RNI-like/FBD-like domain... Lus10023425 21.4 0.7215
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10027365 24.6 0.7214
AT3G49710 Pentatricopeptide repeat (PPR)... Lus10006743 46.5 0.6919
AT3G07130 ATPAP15, PAP15 purple acid phosphatase 15 (.1... Lus10016667 52.2 0.7083
AT3G24000 Tetratricopeptide repeat (TPR)... Lus10002561 59.7 0.6815
AT5G67220 FMN-linked oxidoreductases sup... Lus10006260 68.0 0.6893

Lus10000015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.