Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G28646 97 / 2e-25 WVD2 WAVE-DAMPENED 2, TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2) AT3G23090 94 / 3e-23 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2) AT3G04630 91 / 3e-22 WDL1 WVD2-like 1 (.1.2.3) AT1G54460 84 / 2e-19 TPX2 (targeting protein for Xklp2) protein family (.1) AT2G35880 62 / 1e-11 TPX2 (targeting protein for Xklp2) protein family (.1) AT4G32330 61 / 4e-11 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2), TPX2 (targeting protein for Xklp2) protein family (.3) AT1G70950 58 / 4e-10 TPX2 (targeting protein for Xklp2) protein family (.1) AT2G25480 57 / 8e-10 TPX2 (targeting protein for Xklp2) protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042543 [exp] 278 / 4e-95 AT1G54460 176 / 1e-52 TPX2 (targeting protein for Xklp2) protein family (.1) Lus10022003 [exp] 227 / 8e-75 AT1G54460 172 / 3e-51 TPX2 (targeting protein for Xklp2) protein family (.1) Lus10006563 [exp] 115 / 2e-31 AT1G54460 187 / 2e-57 TPX2 (targeting protein for Xklp2) protein family (.1) Lus10005533 [exp] 115 / 3e-31 AT1G54460 187 / 3e-57 TPX2 (targeting protein for Xklp2) protein family (.1) Lus10022213 [exp] 84 / 2e-19 AT3G23090 220 / 2e-68 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2) Lus10021223 [exp] 84 / 3e-19 AT3G23090 230 / 4e-73 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2) Lus10002915 [exp] 61 / 4e-11 AT4G32330 228 / 2e-70 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2), TPX2 (targeting protein for Xklp2) protein family (.3) Lus10016193 [exp] 59 / 2e-10 AT2G35880 181 / 7e-52 TPX2 (targeting protein for Xklp2) protein family (.1) Lus10029355 [exp] 59 / 3e-10 AT2G35880 185 / 3e-53 TPX2 (targeting protein for Xklp2) protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G042800 [exp] 106 / 1e-27 AT1G54460 176 / 5e-52 TPX2 (targeting protein for Xklp2) protein family (.1) Potri.005G055900 [exp] 99 / 8e-25 AT1G54460 207 / 4e-64 TPX2 (targeting protein for Xklp2) protein family (.1) Potri.010G076200 [exp] 88 / 8e-21 AT3G23090 185 / 5e-55 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2) Potri.008G162800 [exp] 87 / 1e-20 AT3G23090 214 / 1e-66 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2) Potri.018G027500 [exp] 65 / 1e-12 AT4G32330 268 / 2e-85 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2), TPX2 (targeting protein for Xklp2) protein family (.3) Potri.006G254400 [exp] 64 / 4e-12 AT4G32330 288 / 2e-93 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2), TPX2 (targeting protein for Xklp2) protein family (.3) Potri.006G200400 [exp] 58 / 3e-10 AT2G35880 168 / 1e-46 TPX2 (targeting protein for Xklp2) protein family (.1) Potri.008G129300 [exp] 57 / 6e-10 AT1G70950 241 / 2e-72 TPX2 (targeting protein for Xklp2) protein family (.1) Potri.010G113000 [exp] 57 / 7e-10 AT1G70950 147 / 5e-38 TPX2 (targeting protein for Xklp2) protein family (.1) Potri.016G066600 [exp] 56 / 2e-09 AT2G35880 149 / 5e-40 TPX2 (targeting protein for Xklp2) protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06886 [flax] [poplar] TPX2 Targeting protein for Xklp2 (TPX2) domain
Representative CDS sequence Show only first row Show all	>Lus10000016 pacid=23163093 polypeptide=Lus10000016 locus=Lus10000016.g ID=Lus10000016.BGIv1.0 annot-version=v1.0 ATGAATAATGGTAGTAGTACCCCTGTTTCTGATCAGAAAAGCCAGAAGCCAAAAGCTGAGAAGTCAATTGATGGTAAAGTGACGAGCTTTCCCACGCCAA AGTCGTCTAATCTCGGTCCAGGAAGCGCTGAAGCAGTTTGTTTAGAGACTGAAGAGCATGGAGATTATGGGAAGATTTCAGAAAATGATGAGAAACACAA TGATGAAGATGATAAGAACTCGGTTGCTTCCTCGTCAGCTGCATATAAGAATACTAAATCTGCAGTGACTGTTGGCACAGCTCCTCAATTTAAATCTGCT GAGCGTGCCCAAAAGCGGAAGGAGTACTATATGAAATTGGAGGAAAAACGGAAAACTCTCGAGGCTGAGAAAGCTCAAGCTGAGGCCAGGAACAAGGAAG AGCAACAAGCAGCGATCCGACAGATGAGAAAGAACATGATCTTCAAAGCGAACCCAGTCCCCAATTTCTATTATGAGCCACCTCCACCAAAGGTTGAACT CAAGAAGGTTACTCAAACTCTCCATATTGCTTGA
AA sequence Show only first row Show all	>Lus10000016 pacid=23163093 polypeptide=Lus10000016 locus=Lus10000016.g ID=Lus10000016.BGIv1.0 annot-version=v1.0 MNNGSSTPVSDQKSQKPKAEKSIDGKVTSFPTPKSSNLGPGSAEAVCLETEEHGDYGKISENDEKHNDEDDKNSVASSSAAYKNTKSAVTVGTAPQFKSA ERAQKRKEYYMKLEEKRKTLEAEKAQAEARNKEEQQAAIRQMRKNMIFKANPVPNFYYEPPPPKVELKKVTQTLHIA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G28646		WVD2	WAVE-DAMPENED 2, TPX2 (targeti...		Lus10000016 [exp]	0	1
AT3G23950			F-box family protein (.1)		Lus10040838 [exp]	13.4	0.6957
AT5G27510			Protein kinase superfamily pro...		Lus10034285 [exp]	16.5	0.6293
AT1G30840		ATPUP4	purine permease 4 (.1.2)		Lus10002868 [exp]	43.2	0.5733
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10024252 [exp]	49.8	0.5841
AT1G74860			unknown protein		Lus10033128 [exp]	51.6	0.6134
AT5G59350			unknown protein		Lus10005455 [exp]	98.1	0.5702
AT1G13290	C2H2ZnF	WIP6, DOT5	WIP domain protein 6, DEFECTIV...		Lus10035044 [exp]	158.9	0.5357
AT1G19490	bZIP		Basic-leucine zipper (bZIP) tr...		Lus10003255 [exp]	161.6	0.5415
AT2G29060	GRAS		GRAS family transcription fact...		Lus10037752 [exp]	188.1	0.5111
AT4G35150			O-methyltransferase family pro...		Lus10012408 [exp]	195.9	0.5229

Compare expression of checked genes

Lus10000016 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.