Lus10000020 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02750 93 / 4e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G52850 92 / 8e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G56550 91 / 3e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G64310 90 / 6e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G35130 88 / 2e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G33680 88 / 3e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G09950 86 / 9e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G03580 86 / 1e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G13650 86 / 2e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G14850 84 / 4e-19 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027366 277 / 9e-90 AT2G40720 328 / 7e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022974 96 / 4e-23 AT2G03880 542 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013540 95 / 1e-22 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001617 94 / 2e-22 AT2G03880 840 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10017032 87 / 4e-20 AT4G32430 844 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021355 87 / 9e-20 AT4G32430 835 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009913 87 / 1e-19 AT3G09040 1114 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026460 87 / 1e-19 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015256 85 / 4e-19 AT5G46460 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G258500 163 / 1e-46 AT2G40720 481 / 4e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G053566 103 / 2e-28 AT2G34400 80 / 2e-18 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G074000 99 / 3e-24 AT4G39952 892 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.008G052200 95 / 1e-22 AT2G39620 816 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G051300 94 / 2e-22 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G048800 93 / 5e-22 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G043400 92 / 1e-21 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G178200 91 / 3e-21 AT4G35130 919 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G088600 91 / 3e-21 AT1G31430 690 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.011G052300 89 / 9e-21 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10000020 pacid=23165464 polypeptide=Lus10000020 locus=Lus10000020.g ID=Lus10000020.BGIv1.0 annot-version=v1.0
ATGTACAGTGAGCTCAGAAGTCTGAATTCAGCTTATAAGATATTCAACACTACGAGAATCCAGGATGCTGCATTGTGGAACTCCATGATAGCTGCGTTTA
TAGAACACGGTTATCATAAAGAAGCTACTCATCTCTTCATCAGAAAAACAACAGAAGAAGTAACAACAGATTCGACGACATTCGTCATTATGCTTTCCTC
CATTGGAGAGGCTGTAAATGGGTTGGAATTGGGTAGAATGATACATGCTCATGCATTGAAGCTAGGAATTGAAACCGATGTCTCTGTAGGGAACGCCTTG
TTAAGCATGTACGCAGATCGAAACTGCATCGAAGCTGCAAAGGTCTTCTCAGGGATGAAAGAGACTGATGTTGTGTCGTATAACACCATGATTATGGCTA
TAGAGAATGAAGAAGCTTGGGAGTTCTTTGTAGAAATGCAACAATCCGAACTCATGCCAAACGCTTACACAATGGTGTCTCTCCTCGCTTCCTGTAGAGA
TGAACAGATCTCAACATTGGCCGCTCGATCCATGGTGTTGTTGTTAAACAAGGTTTCGATGCCAACTCAGCATTGA
AA sequence
>Lus10000020 pacid=23165464 polypeptide=Lus10000020 locus=Lus10000020.g ID=Lus10000020.BGIv1.0 annot-version=v1.0
MYSELRSLNSAYKIFNTTRIQDAALWNSMIAAFIEHGYHKEATHLFIRKTTEEVTTDSTTFVIMLSSIGEAVNGLELGRMIHAHALKLGIETDVSVGNAL
LSMYADRNCIEAAKVFSGMKETDVVSYNTMIMAIENEEAWEFFVEMQQSELMPNAYTMVSLLASCRDEQISTLAARSMVLLLNKVSMPTQH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G56550 Pentatricopeptide repeat (PPR)... Lus10000020 0 1
AT3G55120 A11, CFI, TT5 TRANSPARENT TESTA 5, CHALCONE ... Lus10030309 2.4 0.8192
AT2G20020 CAF1, ATCAF1 RNA-binding CRS1 / YhbY (CRM) ... Lus10034952 3.7 0.8360
AT3G24000 Tetratricopeptide repeat (TPR)... Lus10038741 5.7 0.7986
AT1G31830 Amino acid permease family pro... Lus10003232 6.3 0.7818
AT5G51010 Rubredoxin-like superfamily pr... Lus10027889 8.5 0.7843
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10006596 10.0 0.7909
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10027365 10.5 0.7866
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Lus10016509 14.2 0.7828
AT3G07190 B-cell receptor-associated pro... Lus10025914 15.7 0.7668
AT3G25970 Pentatricopeptide repeat (PPR)... Lus10030249 15.8 0.7802

Lus10000020 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.