Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26040 57 / 1e-10 HXXXD-type acyl-transferase family protein (.1) AT4G15390 48 / 1e-07 HXXXD-type acyl-transferase family protein (.1) AT1G24420 39 / 0.0002 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025520 [exp] 144 / 6e-45 AT3G26040 64 / 2e-21 HXXXD-type acyl-transferase family protein (.1) Lus10039330 [exp] 99 / 1e-25 AT3G26040 240 / 2e-74 HXXXD-type acyl-transferase family protein (.1) Lus10013231 [exp] 59 / 3e-11 AT3G26040 291 / 5e-94 HXXXD-type acyl-transferase family protein (.1) Lus10025522 [exp] 55 / 4e-10 AT3G26040 236 / 9e-73 HXXXD-type acyl-transferase family protein (.1) Lus10026236 [exp] 53 / 2e-09 AT3G26040 210 / 1e-61 HXXXD-type acyl-transferase family protein (.1) Lus10036929 [exp] 53 / 2e-09 AT3G26040 319 / 1e-102 HXXXD-type acyl-transferase family protein (.1) Lus10019183 [exp] 51 / 1e-08 AT3G26040 265 / 3e-84 HXXXD-type acyl-transferase family protein (.1) Lus10030751 [exp] 51 / 1e-08 AT3G26040 297 / 2e-96 HXXXD-type acyl-transferase family protein (.1) Lus10040354 [exp] 50 / 3e-08 AT3G26040 224 / 1e-67 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G010700 [exp] 60 / 9e-12 AT3G26040 306 / 3e-100 HXXXD-type acyl-transferase family protein (.1) Potri.006G034066 [exp] 58 / 2e-11 AT3G26040 163 / 2e-47 HXXXD-type acyl-transferase family protein (.1) Potri.019G001400 [exp] 55 / 4e-10 AT3G26040 223 / 6e-68 HXXXD-type acyl-transferase family protein (.1) Potri.010G053800 [exp] 55 / 5e-10 AT1G24430 425 / 6e-147 HXXXD-type acyl-transferase family protein (.1) Potri.004G017666 [exp] 50 / 8e-10 AT3G26040 50 / 4e-09 HXXXD-type acyl-transferase family protein (.1) Potri.010G054002 [exp] 53 / 2e-09 AT1G24430 426 / 3e-147 HXXXD-type acyl-transferase family protein (.1) Potri.006G036100 [exp] 52 / 3e-09 AT3G26040 250 / 2e-78 HXXXD-type acyl-transferase family protein (.1) Potri.007G139400 [exp] 52 / 4e-09 AT3G26040 252 / 7e-80 HXXXD-type acyl-transferase family protein (.1) Potri.004G017900 [exp] 52 / 6e-09 AT3G26040 166 / 9e-48 HXXXD-type acyl-transferase family protein (.1) Potri.015G127000 [exp] 51 / 8e-09 AT3G26040 241 / 6e-75 HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10000021 pacid=23142318 polypeptide=Lus10000021 locus=Lus10000021.g ID=Lus10000021.BGIv1.0 annot-version=v1.0 ATGGAGATTCAGACAATTTCCAGATGCCACGTCAGACCTTCTTCCCCAACACCTCCAAATCTCAAGACCTACAACCTCAGCGGCGTTGACCAAATCAACC CGTCCCTCTACGGCCCGTTCATCTTCTACTACCCACCCGACCCGGCCCAACAGCCCGAACCCCGCCGTCCATTCCTCCTCAAACTATCACTGTCCCACAT TTTATCCCCGGTACCCCTTAGCCGGGAGGCTGAGAGACTCCCTATCCGTCGACTGCTGCGACGCCGGAGCCTACTACTCCCAGGCTAA
AA sequence Show only first row Show all	>Lus10000021 pacid=23142318 polypeptide=Lus10000021 locus=Lus10000021.g ID=Lus10000021.BGIv1.0 annot-version=v1.0 MEIQTISRCHVRPSSPTPPNLKTYNLSGVDQINPSLYGPFIFYYPPDPAQQPEPRRPFLLKLSLSHILSPVPLSREAERLPIRRLLRRRSLLLPG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10000021 [exp]	0	1
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10026736 [exp]	10.8	0.8586
AT5G42740			Sugar isomerase (SIS) family p...		Lus10007154 [exp]	23.0	0.8427
AT4G02600		MLO1, ATMLO1	MILDEW RESISTANCE LOCUS O 1, S...		Lus10027093 [exp]	35.7	0.8275
AT1G17100			SOUL heme-binding family prote...		Lus10029117 [exp]	40.1	0.7693
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Lus10036587 [exp]	50.3	0.7625
AT1G51405			myosin-related (.1)		Lus10009954 [exp]	75.0	0.7566
AT2G37195			unknown protein		Lus10026508 [exp]	121.2	0.7817
AT2G41950			unknown protein		Lus10016243 [exp]	181.8	0.7609
AT3G11750		FOLB1	Dihydroneopterin aldolase (.1)		Lus10013600 [exp]	229.9	0.7500
AT3G26750			unknown protein		Lus10016099 [exp]	245.8	0.7487

Compare expression of checked genes

Lus10000021 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.