Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26710 84 / 2e-19 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT1G67110 65 / 1e-12 CYP735A2 "cytochrome P450, family 735, subfamily A, polypeptide 2", cytochrome P450, family 735, subfamily A, polypeptide 2 (.1) AT5G38450 64 / 2e-12 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) AT1G75130 64 / 2e-12 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT1G17060 58 / 2e-10 SHK1, CHI2, SOB7, CYP72C1 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1) AT2G46950 58 / 2e-10 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) AT3G14640 57 / 4e-10 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT4G27710 56 / 8e-10 CYP709B3 "cytochrome P450, family 709, subfamily B, polypeptide 3", cytochrome P450, family 709, subfamily B, polypeptide 3 (.1) AT3G14660 54 / 4e-09 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14690 53 / 1e-08 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036822 [exp] 268 / 8e-88 AT2G26710 410 / 4e-137 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10004633 [exp] 137 / 1e-38 AT2G26710 378 / 4e-126 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036820 [exp] 110 / 8e-29 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036942 [exp] 108 / 8e-28 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10006245 [exp] 104 / 2e-26 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10033044 [exp] 82 / 1e-18 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019184 [exp] 80 / 7e-18 AT3G14680 369 / 2e-122 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) Lus10017771 [exp] 79 / 1e-17 AT2G26710 705 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036817 [exp] 77 / 8e-17 AT2G26710 382 / 3e-121 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139300 [exp] 112 / 1e-29 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139200 [exp] 103 / 2e-26 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G014407 [exp] 102 / 1e-25 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.017G000600 [exp] 100 / 1e-25 AT1G17060 166 / 1e-46 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1) Potri.010G139400 [exp] 101 / 2e-25 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139500 [exp] 98 / 1e-24 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.019G071200 [exp] 99 / 2e-24 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139600 [exp] 90 / 2e-21 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.018G070900 [exp] 88 / 6e-21 AT2G26710 796 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.006G154500 [exp] 87 / 3e-20 AT2G26710 789 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000022 pacid=23155429 polypeptide=Lus10000022 locus=Lus10000022.g ID=Lus10000022.BGIv1.0 annot-version=v1.0 ATGGCCAACTTGACATATAATATTATGATGCTCAACATCACTCTCAAAAGTCTTCTTTATTTAATTCCACTCAACGGAAGAGATAAACTAGGTTCTACTG ATGCGAAAGTTAGAAGAAGAAGTAGATCTAAAGAAAACCTTGAGATGGGAGACCTAATTATGATGCAACTGTTTTTCCTTACCTTGCTTTCTGTTGTCCT TGTTAATATCCTCAGGTTCTTGAATCAAGTATGGCTGAGACCGATCCGGATTCAGTCCGAAATGACTTCTCAGGGGATTAAAGGCCCTCCTTACAGGTTT CTTCATGGAAACACCAAAGAGATCAATGATATGATAAGTCAAGCTGTTAGCAACCCCATGGAAATTTCTCATCAGATTCTCCCCAGAATCATGCCACATG TCCATTCCTGGACAAAGATTTACGGTACCCAGTTTCGGATTCTGGTTTTACTTCTATTGTTGCTCAGTTGCAGATAA
AA sequence Show only first row Show all	>Lus10000022 pacid=23155429 polypeptide=Lus10000022 locus=Lus10000022.g ID=Lus10000022.BGIv1.0 annot-version=v1.0 MANLTYNIMMLNITLKSLLYLIPLNGRDKLGSTDAKVRRRSRSKENLEMGDLIMMQLFFLTLLSVVLVNILRFLNQVWLRPIRIQSEMTSQGIKGPPYRF LHGNTKEINDMISQAVSNPMEISHQILPRIMPHVHSWTKIYGTQFRILVLLLLLLSCR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10000022 [exp]	0	1
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036822 [exp]	1.0	0.8670
AT4G14990			Topoisomerase II-associated pr...		Lus10010445 [exp]	8.8	0.6881
AT4G27595			Plant protein of unknown funct...		Lus10042237 [exp]	16.4	0.7222
					Lus10019691 [exp]	17.5	0.7775
					Lus10004305 [exp]	46.0	0.6420
AT3G10330			Cyclin-like family protein (.1...		Lus10016260 [exp]	47.1	0.6624
AT3G59650			mitochondrial ribosomal protei...		Lus10022178 [exp]	60.5	0.6633
AT5G55490		GEX1, ATGEX1	gamete expressed protein 1 (.1...		Lus10029726 [exp]	64.5	0.6022
AT5G24090		ATCHIA	chitinase A (.1)		Lus10037984 [exp]	67.8	0.6301
AT2G23560		ATMES7	ARABIDOPSIS THALIANA METHYL ES...		Lus10000840 [exp]	118.9	0.6575

Compare expression of checked genes

Lus10000022 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.