Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32440 89 / 1e-21 ATKAO2, CYP88A4, KAO2 ARABIDOPSIS ENT-KAURENOIC ACID HYDROXYLASE 2, ent-kaurenoic acid hydroxylase 2 (.1.2) AT1G05160 80 / 2e-18 ATKAO1, CYP88A3 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) AT5G36110 41 / 6e-05 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT5G05690 40 / 0.0002 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT1G73340 40 / 0.0003 Cytochrome P450 superfamily protein (.1) AT5G36140 39 / 0.0005 CYP716A2 "cytochrome P450, family 716, subfamily A, polypeptide 2", cytochrome P450, family 716, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043357 [exp] 132 / 4e-37 AT2G32440 643 / 0.0 ARABIDOPSIS ENT-KAURENOIC ACID HYDROXYLASE 2, ent-kaurenoic acid hydroxylase 2 (.1.2) Lus10031866 [exp] 42 / 7e-05 AT1G73340 624 / 0.0 Cytochrome P450 superfamily protein (.1) Lus10031295 [exp] 40 / 0.0002 AT1G73340 624 / 0.0 Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G161800 [exp] 85 / 3e-20 AT1G05160 694 / 0.0 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Potri.014G179100 [exp] 82 / 3e-19 AT1G05160 741 / 0.0 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Potri.001G144933 [exp] 58 / 1e-11 AT2G32440 66 / 2e-13 ARABIDOPSIS ENT-KAURENOIC ACID HYDROXYLASE 2, ent-kaurenoic acid hydroxylase 2 (.1.2) Potri.019G080500 [exp] 44 / 1e-05 AT5G36110 456 / 7e-158 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001500 [exp] 43 / 2e-05 AT5G36110 331 / 8e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001300 [exp] 43 / 2e-05 AT5G36110 332 / 2e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017700 [exp] 42 / 3e-05 AT5G36110 304 / 2e-98 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017633 [exp] 42 / 3e-05 AT5G36110 301 / 3e-97 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.013G106200 [exp] 42 / 3e-05 AT5G36110 492 / 2e-171 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.010G189800 [exp] 40 / 0.0002 AT5G05690 717 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000026 pacid=23156070 polypeptide=Lus10000026 locus=Lus10000026.g ID=Lus10000026.BGIv1.0 annot-version=v1.0 ATGGAAGGATGGCGGCGGGATTGCTGGGCGGTAGGGGTCGCGGTGGCGGCGGTAGTGATGGTGAGCTTGAAATGGACGTTGAAGAGAGTGAACGTGTGGT GGTACGAGTCGGAGCTCCCGGATGAAGAAATCCGGCGAAGGCTTCCTCCAGGGGATTACGGCTGGCCGATCATCGGCAACATGTGGTCTTTCCTCTCGGC GTTCAAGTCCGACGACCCTGACTCCTTCATCCGTTCTTTCACCTCCAGGTTTCTCCCGCTTTCAATTCTTTCCATGAATTCGACCTTCAATTTTCCGGCG GGTCTGCTGTCGTTGCATTTGAAATTGTGGAAACCTGGGAATTCGAACTGCGAAATCTTAATCCGCATGGGAGACACGTATGGTTTATTGTTATAA
AA sequence Show only first row Show all	>Lus10000026 pacid=23156070 polypeptide=Lus10000026 locus=Lus10000026.g ID=Lus10000026.BGIv1.0 annot-version=v1.0 MEGWRRDCWAVGVAVAAVVMVSLKWTLKRVNVWWYESELPDEEIRRRLPPGDYGWPIIGNMWSFLSAFKSDDPDSFIRSFTSRFLPLSILSMNSTFNFPA GLLSLHLKLWKPGNSNCEILIRMGDTYGLLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32440		ATKAO2, CYP88A4...	ARABIDOPSIS ENT-KAURENOIC ACID...		Lus10000026 [exp]	0	1
AT5G65630		GTE7	global transcription factor gr...		Lus10010525 [exp]	2.0	0.7834
AT2G01080			Late embryogenesis abundant (L...		Lus10036163 [exp]	8.4	0.7657
AT1G64700			unknown protein		Lus10001663 [exp]	8.6	0.7913
AT3G02850		SKOR	STELAR K+ outward rectifier, S...		Lus10028039 [exp]	10.5	0.7655
AT3G20650			mRNA capping enzyme family pro...		Lus10010478 [exp]	13.2	0.7955
AT1G07710			Ankyrin repeat family protein ...		Lus10015224 [exp]	13.5	0.7515
AT1G44750		ATPUP11	purine permease 11 (.1.2.3)		Lus10019503 [exp]	13.6	0.7115
AT4G14450		ATBET12	unknown protein		Lus10022200 [exp]	14.1	0.7656
AT1G30760			FAD-binding Berberine family p...		Lus10038445 [exp]	14.8	0.7624
AT1G06460		ACD31.2, ACD32....	ALPHA-CRYSTALLIN DOMAIN 31.2, ...		Lus10020785 [exp]	20.5	0.7865

Compare expression of checked genes

Lus10000026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.