Lus10000028 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006075 124 / 4e-39 ND /
Lus10009439 110 / 1e-33 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G082300 65 / 2e-15 ND /
PFAM info
Representative CDS sequence
>Lus10000028 pacid=23143907 polypeptide=Lus10000028 locus=Lus10000028.g ID=Lus10000028.BGIv1.0 annot-version=v1.0
ATGGATAACAGAAAGAGGAAGAAGATAGTCGCAGAACCGACATGGGAAGAGAAGAAGGCCATTGCAGATGAGGAAGAGAAGTCATTGCTCAACGAGATCC
GAGATCTTCGAACATGGATTGGTATGGTGGATGGGATGAACAACGGGGAGTTGATGCAGTACTTGATGAACAGGCCTAAGGAGCTGAAGAGTGTCAAGAT
TCAGAAGACGAGGAAGCAAACTTAA
AA sequence
>Lus10000028 pacid=23143907 polypeptide=Lus10000028 locus=Lus10000028.g ID=Lus10000028.BGIv1.0 annot-version=v1.0
MDNRKRKKIVAEPTWEEKKAIADEEEKSLLNEIRDLRTWIGMVDGMNNGELMQYLMNRPKELKSVKIQKTRKQT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000028 0 1
Lus10006075 1.0 0.9950
AT1G64380 AP2_ERF Integrase-type DNA-binding sup... Lus10003889 3.0 0.9590
Lus10015828 4.9 0.9738
AT5G03610 GDSL-like Lipase/Acylhydrolase... Lus10028145 6.2 0.9720
AT5G15430 Plant calmodulin-binding prote... Lus10003472 6.9 0.9714
AT1G11340 S-locus lectin protein kinase ... Lus10036139 8.1 0.9664
AT2G03200 Eukaryotic aspartyl protease f... Lus10022917 9.2 0.9657
AT3G19760 EIF4A-III eukaryotic initiation factor 4... Lus10040975 11.0 0.9573
AT5G15430 Plant calmodulin-binding prote... Lus10000141 11.2 0.9635
AT2G33530 SCPL46 serine carboxypeptidase-like 4... Lus10040326 12.0 0.9566

Lus10000028 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.