Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13630 86 / 1e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G16890 59 / 2e-11 PPR40 pentatricopeptide (PPR) domain protein 40 (.1) AT3G48810 56 / 3e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G03560 53 / 3e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G09680 53 / 3e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G77340 52 / 1e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G40400 52 / 1e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39710 51 / 2e-08 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G22670 51 / 2e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G19440 51 / 2e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036839 [exp] 238 / 5e-76 AT1G13630 673 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10036836 [exp] 238 / 2e-75 AT1G13630 689 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10019200 [exp] 220 / 1e-68 AT1G13630 690 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10012068 [exp] 57 / 2e-10 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027914 [exp] 57 / 2e-10 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027916 [exp] 57 / 2e-10 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039799 [exp] 55 / 8e-10 AT1G03560 473 / 5e-164 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10026206 [exp] 55 / 1e-09 AT5G14770 717 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018567 [exp] 54 / 1e-09 AT1G03560 862 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G137200 [exp] 130 / 3e-36 AT1G13630 805 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.019G043101 [exp] 61 / 8e-12 AT5G14770 796 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G071600 [exp] 56 / 3e-10 AT5G40400 634 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G276500 [exp] 54 / 2e-09 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G069600 [exp] 53 / 4e-09 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G035700 [exp] 50 / 2e-08 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Potri.019G103400 [exp] 50 / 3e-08 AT1G03560 911 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.008G185000 [exp] 50 / 3e-08 AT1G13040 627 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.015G036400 [exp] 49 / 1e-07 AT1G31840 696 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G038400 [exp] 49 / 1e-07 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10000029 pacid=23163391 polypeptide=Lus10000029 locus=Lus10000029.g ID=Lus10000029.BGIv1.0 annot-version=v1.0 ATGAATGTCAAGCTGACAAAAGTTGCTTACACCACGCTGATCAAGGCATACTGTGCAAAGAGTGGTGATATTGAGAGGGCGGTGGTATTGTTCCATCAAA TGCTGGAAAATGGGTTCAATGTCTCAATTAGAGACTACAGCGCGGTCATCAATCGGTTGTGCAAAAGAAATTTTGTAGTTGAAGCCAAATACTTTCTGCA GATGATGTTATGCAATGACGTTTTCCCTGATTGGGATATCTGTCATATGATGATTACTACACTACACAGTAACAGCCATTTCGATCAAGTAGCTGAGTTG CTTGCTATCGCAATCAAGTTTGGTTGTATCGTGGAAAGTTGA
AA sequence Show only first row Show all	>Lus10000029 pacid=23163391 polypeptide=Lus10000029 locus=Lus10000029.g ID=Lus10000029.BGIv1.0 annot-version=v1.0 MNVKLTKVAYTTLIKAYCAKSGDIERAVVLFHQMLENGFNVSIRDYSAVINRLCKRNFVVEAKYFLQMMLCNDVFPDWDICHMMITTLHSNSHFDQVAEL LAIAIKFGCIVES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G13630			Tetratricopeptide repeat (TPR)...		Lus10000029 [exp]	0	1
AT2G03880		REME1	required for efficiency of mit...		Lus10005642 [exp]	3.0	0.7631
AT5G14070		ROXY2	Thioredoxin superfamily protei...		Lus10038514 [exp]	14.8	0.7340
					Lus10011249 [exp]	34.6	0.7154
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10017346 [exp]	37.7	0.6572
AT2G28610	HD	PRS1, PRS, WOX3	WUSCHEL RELATED HOMEOBOX 3, PR...		Lus10038480 [exp]	47.8	0.7146
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10008713 [exp]	52.0	0.6164
AT3G50390			Transducin/WD40 repeat-like su...		Lus10011699 [exp]	62.2	0.6919
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Lus10018101 [exp]	69.8	0.6823
AT3G25970			Pentatricopeptide repeat (PPR)...		Lus10004003 [exp]	95.3	0.6713
AT1G76750			Protein of unknown function (D...		Lus10027057 [exp]	121.5	0.6327

Compare expression of checked genes

Lus10000029 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.