Lus10000030 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20140 243 / 7e-80 RPT2b regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
AT4G29040 243 / 8e-80 RPT2A regulatory particle AAA-ATPase 2A (.1)
AT5G58290 57 / 4e-10 RPT3 regulatory particle triple-A ATPase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006976 257 / 2e-85 AT4G29040 828 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Lus10019995 257 / 4e-81 AT2G20140 827 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10022834 247 / 6e-81 AT2G20140 735 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10011901 247 / 5e-80 AT2G20140 844 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10001313 185 / 5e-58 AT4G29040 673 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Lus10015523 138 / 8e-43 AT4G29040 134 / 1e-38 regulatory particle AAA-ATPase 2A (.1)
Lus10015524 108 / 9e-29 AT2G20140 659 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G252600 246 / 3e-81 AT4G29040 838 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Potri.014G194700 244 / 2e-80 AT4G29040 829 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Potri.006G029100 58 / 8e-11 AT5G58290 308 / 2e-105 regulatory particle triple-A ATPase 3 (.1)
Potri.016G028000 58 / 2e-10 AT5G58290 781 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Potri.006G031000 57 / 5e-10 AT5G58290 771 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Potri.006G028200 45 / 2e-06 AT5G58290 193 / 2e-60 regulatory particle triple-A ATPase 3 (.1)
PFAM info
Representative CDS sequence
>Lus10000030 pacid=23162274 polypeptide=Lus10000030 locus=Lus10000030.g ID=Lus10000030.BGIv1.0 annot-version=v1.0
ATGGGCCGGCCTCCGGGAGACAGGAAAGGCGACGGAGACAACAAGAAGGAGAAGAAGTACGAGCCAGCCGCGCCGCCTTCCCGCGTCGGACGGAAGCAGC
GGAAGCAGAAGGGCTCCGAGACGGCGGCGAGGCTTCCGACGGTGACGCCTTTGACGAAGTGCAAGCTCCGCCTTCTGAAGATGGAACGGATCAAGGATTA
CTTGTTGATGGAGGAAGAGTTCGTCGCCAATCAGGAGAGGCTGAAGCCTCAGGAGGAGAAGAACGAGGAGGATCGTTCTAAGGTCGACGATCTCAGGGGA
TCTCCGATGAGCGTCGGGAATCTGGAGGAGCTGATTGACGAGAACCACGCTATTGTTTCTTCCTCGGTTGGTCCGGAGTATTATGTTGGGATTTTGTCGT
TCGTTGATAAGGATCAGATTGAGCCTGGCTGCGCAATTTTGATGCACAATAAGGTAATCTATTAG
AA sequence
>Lus10000030 pacid=23162274 polypeptide=Lus10000030 locus=Lus10000030.g ID=Lus10000030.BGIv1.0 annot-version=v1.0
MGRPPGDRKGDGDNKKEKKYEPAAPPSRVGRKQRKQKGSETAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKNEEDRSKVDDLRG
SPMSVGNLEELIDENHAIVSSSVGPEYYVGILSFVDKDQIEPGCAILMHNKVIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29040 RPT2A regulatory particle AAA-ATPase... Lus10000030 0 1
AT5G08530 CI51 51 kDa subunit of complex I (.... Lus10015808 6.7 0.8507
AT4G34450 coatomer gamma-2 subunit, puta... Lus10042326 7.2 0.8703
AT5G57460 unknown protein Lus10004736 8.9 0.8508
AT1G07510 FTSH10 FTSH protease 10 (.1) Lus10004973 8.9 0.8315
AT3G06720 IMPA1, IMPA-1, ... importin alpha isoform 1 (.1.2... Lus10031398 9.2 0.8446
AT4G04950 AtGRXS17 Arabidopsis thaliana monothiol... Lus10011188 10.8 0.8472
AT3G57890 Tubulin binding cofactor C dom... Lus10023821 11.0 0.8413
AT1G05520 Sec23/Sec24 protein transport ... Lus10041256 14.4 0.8417
AT1G05520 Sec23/Sec24 protein transport ... Lus10021964 16.3 0.8446
AT4G16143 IMPA-2 importin alpha isoform 2 (.1.2... Lus10041124 19.4 0.8092

Lus10000030 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.