Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60600 91 / 7e-24 (AT)VAP, (AT)VAP, (AT)VAP, (AT)VAP, (AT)VAP, (AT)VAP, (AT)VAP, VAP27-1, VAP27, (AT)VAP, (AT)VAP, (A VAMP/SYNAPTOBREVIN-ASSOCIATED PROTEIN 27-1, vesicle associated protein (.1.2.3) AT2G45140 90 / 2e-23 PVA12 plant VAP homolog 12 (.1) AT4G00170 84 / 5e-21 Plant VAMP (vesicle-associated membrane protein) family protein (.1) AT2G23830 77 / 2e-19 PapD-like superfamily protein (.1) AT1G51270 73 / 1e-16 structural molecules;transmembrane receptors;structural molecules (.1.2.3.4) AT5G47180 66 / 2e-14 Plant VAMP (vesicle-associated membrane protein) family protein (.1), Plant VAMP (vesicle-associated membrane protein) family protein (.2) AT1G08820 63 / 7e-13 VAP27-2 vamp/synaptobrevin-associated protein 27-2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000032 [exp] 133 / 8e-42 AT2G45140 148 / 7e-46 plant VAP homolog 12 (.1) Lus10008512 [exp] 134 / 1e-40 AT2G45140 296 / 7e-102 plant VAP homolog 12 (.1) Lus10007463 [exp] 122 / 2e-35 AT3G60600 306 / 4e-105 VAMP/SYNAPTOBREVIN-ASSOCIATED PROTEIN 27-1, vesicle associated protein (.1.2.3) Lus10028937 [exp] 124 / 6e-35 AT3G60600 305 / 2e-101 VAMP/SYNAPTOBREVIN-ASSOCIATED PROTEIN 27-1, vesicle associated protein (.1.2.3) Lus10010360 [exp] 94 / 6e-25 AT4G00170 311 / 5e-108 Plant VAMP (vesicle-associated membrane protein) family protein (.1) Lus10015885 [exp] 87 / 2e-22 AT2G45140 307 / 2e-106 plant VAP homolog 12 (.1) Lus10036495 [exp] 87 / 3e-22 AT4G00170 316 / 4e-110 Plant VAMP (vesicle-associated membrane protein) family protein (.1) Lus10009279 [exp] 87 / 2e-21 AT4G00060 1034 / 0.0 maternal effect embryo arrest 44, Nucleotidyltransferase family protein (.1) Lus10011004 [exp] 68 / 2e-15 AT5G47180 167 / 2e-52 Plant VAMP (vesicle-associated membrane protein) family protein (.1), Plant VAMP (vesicle-associated membrane protein) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G152000 [exp] 105 / 3e-29 AT2G45140 296 / 6e-102 plant VAP homolog 12 (.1) Potri.002G144000 [exp] 96 / 9e-26 AT3G60600 298 / 1e-102 VAMP/SYNAPTOBREVIN-ASSOCIATED PROTEIN 27-1, vesicle associated protein (.1.2.3) Potri.003G076100 [exp] 95 / 2e-25 AT2G45140 262 / 1e-88 plant VAP homolog 12 (.1) Potri.014G060900 [exp] 94 / 4e-25 AT2G45140 328 / 9e-115 plant VAP homolog 12 (.1) Potri.002G144800 [exp] 88 / 7e-23 AT4G00170 313 / 5e-109 Plant VAMP (vesicle-associated membrane protein) family protein (.1) Potri.005G044900 [exp] 67 / 3e-14 AT1G08820 261 / 4e-84 vamp/synaptobrevin-associated protein 27-2 (.1.2) Potri.013G031400 [exp] 66 / 5e-14 AT1G08820 273 / 5e-89 vamp/synaptobrevin-associated protein 27-2 (.1.2) Potri.001G152100 [exp] 64 / 9e-14 AT5G47180 229 / 4e-76 Plant VAMP (vesicle-associated membrane protein) family protein (.1), Plant VAMP (vesicle-associated membrane protein) family protein (.2) Potri.003G082500 [exp] 60 / 4e-12 AT5G47180 281 / 1e-96 Plant VAMP (vesicle-associated membrane protein) family protein (.1), Plant VAMP (vesicle-associated membrane protein) family protein (.2) Potri.010G031601 [exp] 46 / 4e-07 AT2G45140 112 / 4e-29 plant VAP homolog 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000031 pacid=23149887 polypeptide=Lus10000031 locus=Lus10000031.g ID=Lus10000031.BGIv1.0 annot-version=v1.0 ATGCAAGCGCAGAAGGAAGCTCCTCCGGATATGCAATGCAAGGACAAATTCTTGCTTCAGAGCGTAAAAGCTCCAGAGGGTTCGACTGTAAAGGATATCA CTGCTGAGATGTTCAATAAGGAGGCTGGACATATAGTTGAGGAAACCAAGTTGAAGGTTGTTTATGTTGCCCCACCTCAACCTCCTTCTCCTGTTCCCGA AGGTTCAGAGGAAGGATCATCTCCTCGCGGTTCTGTCTCGGACAATGGACATGTAAACGGTGCTGAGTTTGCTGCTGTGAGTGCTAACTAA
AA sequence Show only first row Show all	>Lus10000031 pacid=23149887 polypeptide=Lus10000031 locus=Lus10000031.g ID=Lus10000031.BGIv1.0 annot-version=v1.0 MQAQKEAPPDMQCKDKFLLQSVKAPEGSTVKDITAEMFNKEAGHIVEETKLKVVYVAPPQPPSPVPEGSEEGSSPRGSVSDNGHVNGAEFAAVSAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60600		(AT)VAP, (AT)VA...	VAMP/SYNAPTOBREVIN-ASSOCIATED ...		Lus10000031 [exp]	0	1
AT1G08750			Peptidase C13 family (.1.2.3)		Lus10006570 [exp]	13.7	0.7570
AT3G27000		ATARP2, WRM, AR...	WURM, actin related protein 2 ...		Lus10041069 [exp]	22.5	0.7482
AT1G13560		AAPT1, ATAAPT1	aminoalcoholphosphotransferase...		Lus10019149 [exp]	60.8	0.6581

Compare expression of checked genes

Lus10000031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.