Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49180 129 / 4e-36 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G06830 127 / 1e-35 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G27870 122 / 2e-33 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G05610 117 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G11580 112 / 3e-30 ATPMEPCRA methylesterase PCR A (.1) AT3G10720 107 / 1e-29 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) AT4G02300 106 / 7e-28 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G04970 105 / 1e-27 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT2G47550 105 / 1e-27 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT4G02320 104 / 2e-27 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029866 [exp] 262 / 6e-83 AT1G02810 511 / 6e-170 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10015211 [exp] 228 / 2e-72 AT3G05610 420 / 3e-137 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10031469 [exp] 226 / 5e-72 AT3G05610 442 / 4e-147 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10020681 [exp] 186 / 3e-56 AT3G05610 87 / 3e-33 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10006940 [exp] 120 / 5e-33 AT3G05610 569 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10008203 [exp] 112 / 6e-30 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10020909 [exp] 111 / 1e-29 AT3G05610 547 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10037489 [exp] 109 / 1e-28 AT5G27870 480 / 3e-164 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10033466 [exp] 108 / 1e-28 AT3G05610 556 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G013400 [exp] 170 / 3e-51 AT3G05610 580 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.005G022900 [exp] 159 / 2e-47 AT3G05610 593 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.010G010464 [exp] 128 / 8e-36 AT5G27870 619 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.008G011200 [exp] 112 / 4e-30 AT3G10710 621 / 0.0 root hair specific 12 (.1) Potri.010G247700 [exp] 111 / 1e-29 AT3G10720 746 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) Potri.010G247600 [exp] 110 / 3e-29 AT3G10710 609 / 0.0 root hair specific 12 (.1) Potri.001G162500 [exp] 108 / 1e-28 AT3G14310 541 / 0.0 pectin methylesterase 3 (.1) Potri.001G209000 [exp] 107 / 4e-28 AT4G33230 483 / 2e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.003G021600 [exp] 107 / 4e-28 AT4G33230 484 / 1e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.001G162600 [exp] 107 / 4e-28 AT3G14310 551 / 0.0 pectin methylesterase 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF01095 [flax] [poplar] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Lus10000034 pacid=23139619 polypeptide=Lus10000034 locus=Lus10000034.g ID=Lus10000034.BGIv1.0 annot-version=v1.0 ATGAAGGCCGACCGGAAGGAGTTCAAGTCGTACTTGGGCCGGCCATGGAAGAATTTCTCCAGGACCATCATTATGGAGACGTTCATCGACGATCTGATCG ACCCTGAAGGATGGCTGCCGTGGATGGGTACCATCGGGACCAAGACTTGCTGGTACGGTGAGTTCGGAAATTACGGTCCCGGCGCCGATCAGAGCAAGAG GGTGACGTGGCAGGGGATTAAGAAGATTACGCCGCAGCATGCCGTGGATTTCACTCCCCAGCGGTTCATCCGGTCCGACCCGTGGGTTAAGCCGACCGGG ATACCGTACATTTCATATATGGTTAAACCGTCCAAGTCACGACGGGTTGATACGGAGTTAATCGAGTAA
AA sequence Show only first row Show all	>Lus10000034 pacid=23139619 polypeptide=Lus10000034 locus=Lus10000034.g ID=Lus10000034.BGIv1.0 annot-version=v1.0 MKADRKEFKSYLGRPWKNFSRTIIMETFIDDLIDPEGWLPWMGTIGTKTCWYGEFGNYGPGADQSKRVTWQGIKKITPQHAVDFTPQRFIRSDPWVKPTG IPYISYMVKPSKSRRVDTELIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06830			Plant invertase/pectin methyle...		Lus10000034 [exp]	0	1
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10023901 [exp]	3.2	0.8249
					Lus10012561 [exp]	5.1	0.6903
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029385 [exp]	11.4	0.7964
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10018983 [exp]	13.0	0.7417
AT1G55230			Family of unknown function (DU...		Lus10039191 [exp]	32.9	0.7888
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015746 [exp]	36.2	0.7659
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031157 [exp]	42.9	0.7097
					Lus10015147 [exp]	50.0	0.7362
					Lus10041547 [exp]	57.1	0.6675
AT1G11410			S-locus lectin protein kinase ...		Lus10007608 [exp]	62.9	0.6867

Compare expression of checked genes

Lus10000034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.