Lus10000035 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18940 281 / 5e-90 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G02860 171 / 3e-49 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39710 115 / 1e-29 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12775 115 / 1e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 114 / 3e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G04760 112 / 2e-28 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G64320 110 / 9e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G11690 108 / 2e-27 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G63230 106 / 2e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G06000 108 / 4e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000036 446 / 6e-162 AT2G18940 279 / 4e-89 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020002 461 / 5e-159 AT2G18940 1015 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015530 451 / 4e-155 AT2G18940 1010 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006962 312 / 9e-102 AT2G18940 976 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025473 310 / 5e-101 AT2G18940 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002107 164 / 2e-46 AT5G02860 1040 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013894 163 / 3e-46 AT5G02860 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10028943 114 / 6e-31 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021074 112 / 5e-29 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G166200 294 / 8e-95 AT2G18940 1082 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G092100 176 / 5e-51 AT5G02860 1146 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G297300 174 / 2e-50 AT5G02860 1129 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G109500 122 / 4e-32 AT1G09900 855 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G050400 118 / 1e-30 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G045000 118 / 2e-30 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050300 117 / 2e-30 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046000 115 / 1e-29 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G032600 114 / 2e-29 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G047000 114 / 3e-29 AT3G04760 781 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10000035 pacid=23146548 polypeptide=Lus10000035 locus=Lus10000035.g ID=Lus10000035.BGIv1.0 annot-version=v1.0
ATGGAAAGGGCATTCGAGGTACTAAAGAAGCACGGGTACAAAATCGACCTGGTTCTTTACAACGCAATGTTATCAATGTTCGCCAAGAATAACTTAACCG
ACAGGGCCCACGAGATGCTAAGGACTATCCGCAAGAGCGGGTTGCATCCTGACCTTGTCAGCTATAACAACTTGATGGACATGTACGCTCGAGGTGGAGA
TTGCTGGAAGGCAGAAGAGATCCTGAAAGGGCTACAAGATTCCGGTGGGAAACCAGATGTGGTATCGTACAACACAGTGATCAAAGGGTTCTGTAGAAAA
GGGCTTATGCAAGAAGCGTTTCGAGTTCTGTCGGAGATGACCTCACGGGGTATCAGGCCTTGCATTTTCACGTACAACACGTTTGTAACAGGGTATGTCG
GAGAAGGGAGGGTCGGGGAGATAATAGATGTTGTGAGGTATATGGTTGAGCACGGTTGCAGGCCGGAGATGCTGACGTACAAGATTGCAGTGGATGGTTA
CTGCAAGGCGAGGAAATATAAAGAGGCGCTGGAGTTCATATCGCAGATTAAGAGTATAGACAAGTGGTTCGATTTGGAGACTGAGCAAAGACTGGCTACT
CATGTTCGGGATATGTCCAAGTCTACAAGTCATCATGATTGTTTGACCAGGTAA
AA sequence
>Lus10000035 pacid=23146548 polypeptide=Lus10000035 locus=Lus10000035.g ID=Lus10000035.BGIv1.0 annot-version=v1.0
MERAFEVLKKHGYKIDLVLYNAMLSMFAKNNLTDRAHEMLRTIRKSGLHPDLVSYNNLMDMYARGGDCWKAEEILKGLQDSGGKPDVVSYNTVIKGFCRK
GLMQEAFRVLSEMTSRGIRPCIFTYNTFVTGYVGEGRVGEIIDVVRYMVEHGCRPEMLTYKIAVDGYCKARKYKEALEFISQIKSIDKWFDLETEQRLAT
HVRDMSKSTSHHDCLTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10000035 0 1
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10000036 1.0 0.9716
AT5G48370 Thioesterase/thiol ester dehyd... Lus10008740 2.8 0.9083
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10014694 4.5 0.9266
AT2G30570 PSBW photosystem II reaction center... Lus10014751 5.1 0.9355
AT3G09650 CRM3, HCF152 HIGH CHLOROPHYLL FLUORESCENCE ... Lus10023168 5.3 0.9088
AT4G25910 ATCNFU3, NFU3 NFU domain protein 3 (.1) Lus10001634 6.0 0.9306
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10015530 7.7 0.8992
AT4G34190 SEP1 stress enhanced protein 1 (.1) Lus10002821 10.0 0.9142
AT2G38270 ATGRX2, CXIP2 GLUTAREDOXIN, CAX-interacting ... Lus10002847 10.0 0.9046
AT5G48300 APS1, ADG1 ADP-GLUCOSE PYROPHOSPHORYLASE ... Lus10025187 12.4 0.8698

Lus10000035 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.