Lus10000036 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18940 279 / 5e-89 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G02860 171 / 3e-49 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39710 114 / 3e-29 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G09900 113 / 7e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G12775 113 / 9e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G04760 111 / 3e-28 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G64320 109 / 2e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G26790 109 / 2e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G11690 108 / 5e-27 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G28010 107 / 6e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000035 446 / 6e-162 AT2G18940 281 / 6e-90 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015530 461 / 4e-159 AT2G18940 1010 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020002 450 / 8e-155 AT2G18940 1015 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006962 312 / 9e-102 AT2G18940 976 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025473 310 / 6e-101 AT2G18940 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002107 164 / 7e-47 AT5G02860 1040 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013894 164 / 1e-46 AT5G02860 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10028943 110 / 1e-29 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027267 113 / 9e-29 AT1G74580 813 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G166200 292 / 5e-94 AT2G18940 1082 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G092100 176 / 4e-51 AT5G02860 1146 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G297300 175 / 2e-50 AT5G02860 1129 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G109500 125 / 5e-33 AT1G09900 855 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G050400 120 / 2e-31 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050300 120 / 2e-31 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G045000 120 / 2e-31 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046000 117 / 4e-30 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G046100 116 / 5e-30 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050500 115 / 8e-30 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10000036 pacid=23153416 polypeptide=Lus10000036 locus=Lus10000036.g ID=Lus10000036.BGIv1.0 annot-version=v1.0
ATGGAAAGGGCATTCGAGGCACTAAAGAAGCACGGGTACAAAATCGACCTGGTTCTTTACAACGCAATGTTATCAATGTTCGCCAAGAACAACTTAACCG
ACAGGGCTCACGAGATGCTAAGGACTATCCGCAAGAGCGGGTTGCATCCGGACCTCGTCAGCTATAACAACTTGATGGACATGTACGCTCGAGTTGGAGA
TTGCTGGAAGGCAGAAGAGATCCTGAAAGGGCTGCAAGATTCGGGTGGCAAACCAGACGTGATATCATACAACACAGTGATCAAAGGGTTCTGTAGAAAA
GGGCTTATGCAAGAAGCGTTTCGAGTTCTGTCGGAGATGACCTCACGGGGTGTCAGGCCTTGCATTTTCACGTACAATACTTTTGTAACCGGGTATGTCG
GAGAAGGGAGGGTTGGGGAGATAATAGATGTTGTGAGGTACATGGTTGAGCACGGTTGTAGGCCGGAGATGCTGACGTACAAGATTGCAGTGGATGGTTA
CTGCAAAGCGAGGAAGTATAAAGAGGCGCTGGAATTCATATCGCAGATTAAGAGTATAGACAAGTGGTTCGATTTGGAGACTGAGCAAAGACTGGCTACT
CATGTTCGGGATATGTCCAAGTCTGCAAGTCATCATGATTGTTTGCCCAGGTAA
AA sequence
>Lus10000036 pacid=23153416 polypeptide=Lus10000036 locus=Lus10000036.g ID=Lus10000036.BGIv1.0 annot-version=v1.0
MERAFEALKKHGYKIDLVLYNAMLSMFAKNNLTDRAHEMLRTIRKSGLHPDLVSYNNLMDMYARVGDCWKAEEILKGLQDSGGKPDVISYNTVIKGFCRK
GLMQEAFRVLSEMTSRGVRPCIFTYNTFVTGYVGEGRVGEIIDVVRYMVEHGCRPEMLTYKIAVDGYCKARKYKEALEFISQIKSIDKWFDLETEQRLAT
HVRDMSKSASHHDCLPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10000036 0 1
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10000035 1.0 0.9716
AT3G09650 CRM3, HCF152 HIGH CHLOROPHYLL FLUORESCENCE ... Lus10023168 1.7 0.9267
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10014694 2.4 0.9298
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10010909 5.2 0.9024
AT3G20680 Domain of unknown function (DU... Lus10006345 5.7 0.8902
AT5G48370 Thioesterase/thiol ester dehyd... Lus10008740 6.2 0.8776
AT2G37920 EMB1513 embryo defective 1513, copper ... Lus10002043 7.1 0.8993
AT1G20340 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REP... Lus10034554 7.7 0.9101
AT2G38270 ATGRX2, CXIP2 GLUTAREDOXIN, CAX-interacting ... Lus10002847 9.2 0.9038
AT4G25910 ATCNFU3, NFU3 NFU domain protein 3 (.1) Lus10001634 9.4 0.9154

Lus10000036 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.