Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66540 177 / 2e-54 Cytochrome P450 superfamily protein (.1.2) AT4G37320 176 / 1e-52 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT4G37360 175 / 3e-52 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) AT4G37330 174 / 6e-52 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT4G37430 169 / 5e-50 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1) AT3G28740 168 / 1e-49 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT4G37370 167 / 2e-49 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37400 165 / 2e-48 CYP81F3 "cytochrome P450, family 81, subfamily F, polypeptide 3", cytochrome P450, family 81, subfamily F, polypeptide 3 (.1) AT4G37410 164 / 5e-48 CYP81F4 "cytochrome P450, family 81, subfamily F, polypeptide 4", cytochrome P450, family 81, subfamily F, polypeptide 4 (.1) AT5G36220 162 / 2e-47 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024078 [exp] 341 / 4e-116 AT4G37320 437 / 3e-149 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10041643 [exp] 323 / 2e-109 AT4G37320 433 / 6e-148 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10027614 [exp] 175 / 1e-52 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10020437 [exp] 175 / 3e-52 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018717 [exp] 173 / 2e-51 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024819 [exp] 168 / 2e-49 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10032856 [exp] 160 / 2e-49 AT1G66540 215 / 2e-69 Cytochrome P450 superfamily protein (.1.2) Lus10018712 [exp] 160 / 1e-48 AT4G37340 279 / 8e-94 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Lus10011958 [exp] 165 / 3e-48 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020600 [exp] 173 / 1e-51 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121100 [exp] 171 / 7e-51 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020500 [exp] 169 / 6e-50 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020432 [exp] 165 / 1e-48 AT4G37370 440 / 4e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021700 [exp] 164 / 7e-48 AT5G10600 436 / 7e-149 "cytochrome P450, family 81, subfamily K, polypeptide 2", cytochrome P450, family 81, subfamily K, polypeptide 2 (.1) Potri.005G143800 [exp] 162 / 3e-47 AT4G37370 539 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G008200 [exp] 162 / 4e-47 AT4G37370 531 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021800 [exp] 162 / 5e-47 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Potri.003G007000 [exp] 159 / 4e-46 AT4G37370 525 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G007900 [exp] 159 / 6e-46 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10000038 pacid=23162262 polypeptide=Lus10000038 locus=Lus10000038.g ID=Lus10000038.BGIv1.0 annot-version=v1.0 ATGGAATGGGCAATGGCGTTGCTGCTTAAGAATCCAGAAGCTATGAAGAAAGTAGAAGCAGAGATAGGGCAGAATGTTGGGCTAGACCGTTTGGTGGAGG AAAGAGATTTGTGCAAGTTGACTTACCTGCAAAACGTGATCGATGAGACGCTCCGGCTGTATCCACCCGTTCCATTGCTGATCCCACACGAATCGAGCGA GGCAACGAGGGTGTGTGGGTTTGATGTGCCGAAAGGAACAATGCTGCTCGTCAATGCTTGGTCTTTGCACAGGGATCCAGAGCTGTGGGAGGATCCAGAG AGGTTTTTTCCGGGGAGATTTGATCGGGTCTGTGATCATGATGATGATGGTGATGTTGATCAATCGACCAAGGTTAAGAAGAAGAACAAATACAAGCTAG TTCCGTTTGGGGAAGGGAGAAGGGCTTGCCCAGGGGATGTTCTTGGTAAGAAAGTTGTGGGGCTGGCTTTGGGTGCGGTGGTTCAGGCATTTAAGTTGAG TAAGATTGAAGGAGACAGGGAGATTGATATGGATGAGGGAACTGGGTTGACCATGTCCAGAGCTAACCCCTTGGAGGTTGTTTGTAAACCTCGTAGCAAA GCAATTGCCGACATTCTCATGTCCACCACGTCCTAG
AA sequence Show only first row Show all	>Lus10000038 pacid=23162262 polypeptide=Lus10000038 locus=Lus10000038.g ID=Lus10000038.BGIv1.0 annot-version=v1.0 MEWAMALLLKNPEAMKKVEAEIGQNVGLDRLVEERDLCKLTYLQNVIDETLRLYPPVPLLIPHESSEATRVCGFDVPKGTMLLVNAWSLHRDPELWEDPE RFFPGRFDRVCDHDDDGDVDQSTKVKKKNKYKLVPFGEGRRACPGDVLGKKVVGLALGAVVQAFKLSKIEGDREIDMDEGTGLTMSRANPLEVVCKPRSK AIADILMSTTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37320		CYP81D5	"cytochrome P450, family 81, s...		Lus10000038 [exp]	0	1
AT4G37320		CYP81D5	"cytochrome P450, family 81, s...		Lus10024078 [exp]	1.0	0.9897
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036820 [exp]	1.4	0.9836
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10032745 [exp]	2.4	0.9828
AT3G46540			ENTH/VHS family protein (.1)		Lus10040297 [exp]	3.5	0.9778
AT5G43540	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10014755 [exp]	3.5	0.9705
AT3G14610		CYP72A7	"cytochrome P450, family 72, s...		Lus10036823 [exp]	3.7	0.9695
AT5G13750		ZIFL1	zinc induced facilitator-like ...		Lus10034847 [exp]	4.9	0.9681
AT2G37050			Leucine-rich repeat protein ki...		Lus10004275 [exp]	5.5	0.9751
					Lus10008301 [exp]	6.0	0.9673
AT2G40260	GARP		Homeodomain-like superfamily p...		Lus10040945 [exp]	7.4	0.9676

Compare expression of checked genes

Lus10000038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.