Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13825 65 / 4e-15 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001690 [exp] 184 / 5e-62 AT5G13825 66 / 9e-15 unknown protein Lus10005167 [exp] 138 / 8e-44 AT5G13825 69 / 5e-16 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000042 pacid=23139512 polypeptide=Lus10000042 locus=Lus10000042.g ID=Lus10000042.BGIv1.0 annot-version=v1.0 ATGCCGGCGCCGAAGACGGTAGCGGTGGGCATAATAGAACAGGTGATTCGGAGAAGGAGAAACCGTCCTGGGACAACTTCCTACTACTATGACAACAATA CCCCTGTTTTTGGCTGGCTTCTCCGCGGTTGGGTTGTTGAAGAGAGAACCGTCCCCAATGGACGAGTTTATCGATATTACTATGATCCGTTTGGGCAGAT GTATATGTCCAAAGCTGAAGTACTTGTGACATGGGAGCAGCAGGCTGGTATCATTCTCGTACATTAG
AA sequence Show only first row Show all	>Lus10000042 pacid=23139512 polypeptide=Lus10000042 locus=Lus10000042.g ID=Lus10000042.BGIv1.0 annot-version=v1.0 MPAPKTVAVGIIEQVIRRRRNRPGTTSYYYDNNTPVFGWLLRGWVVEERTVPNGRVYRYYYDPFGQMYMSKAEVLVTWEQQAGIILVH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G13825			unknown protein		Lus10000042 [exp]	0	1
					Lus10002411 [exp]	1.0	0.9997
					Lus10019564 [exp]	2.0	0.9980
AT2G16460			Protein of unknown function (D...		Lus10041812 [exp]	2.2	0.9840
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10002774 [exp]	3.0	0.9932
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031007 [exp]	4.0	0.9887
AT3G19010			2-oxoglutarate (2OG) and Fe(II...		Lus10004245 [exp]	4.7	0.9575
AT4G31920	GARP	ARR10	response regulator 10 (.1)		Lus10025044 [exp]	6.0	0.9798
					Lus10014195 [exp]	7.5	0.9720
					Lus10020194 [exp]	7.9	0.9670
					Lus10010397 [exp]	8.9	0.9696

Compare expression of checked genes

Lus10000042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.