Lus10000043 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71490 245 / 1e-77 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49142 180 / 3e-53 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 179 / 2e-52 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21065 165 / 5e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G48910 167 / 8e-49 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G22830 168 / 9e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT4G21300 169 / 1e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G09410 167 / 2e-48 pentatricopeptide (PPR) repeat-containing protein (.1)
AT4G13650 168 / 3e-48 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G22070 167 / 4e-48 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009487 372 / 3e-125 AT1G71490 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003508 351 / 2e-121 AT1G71490 415 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027008 256 / 8e-83 AT1G71490 335 / 7e-107 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015898 181 / 4e-53 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009269 178 / 1e-52 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013991 177 / 3e-51 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020588 166 / 4e-51 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028855 176 / 9e-51 AT4G21300 873 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008967 175 / 9e-51 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G074700 274 / 3e-88 AT1G71490 878 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G027800 187 / 3e-55 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G047800 180 / 2e-52 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G048800 176 / 3e-51 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G044700 175 / 4e-51 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G187800 176 / 5e-51 AT3G09040 1201 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G012500 173 / 1e-50 AT3G49710 995 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G237000 172 / 2e-50 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G041200 171 / 2e-49 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G018700 171 / 3e-49 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10000043 pacid=23162263 polypeptide=Lus10000043 locus=Lus10000043.g ID=Lus10000043.BGIv1.0 annot-version=v1.0
ATGGTTGAGGTTCTGTCAGCTTGTAGCCATTCCGGTCTAGTAAAAGAAGGGGAAATGCTGTTTCGAGAAATGTTTAGTGTTTACGACATCGTTCCTCGAT
TAGAGCATTACGATTGCATGGTGGATCTCTTTGGGAGGGCAGGGATGTTAAATCAAGCGAAGGAGATCGTGTTAACTATGCCTTACAGTCCAACAGCTGA
AATATGGGCTACTCTCTTAGGAGCTTGCCGGATTCACGGAAATACAGATATAGGGGAATGGGCAGCTAATCGTTTGCTAGAGATGAAACCGGAAAATTCG
GGGTATTATGTGTTGATTGCCAACATGTATGCTGCTGCCGGAAGCTGGGATAAGCTGGCTAAAGTTCGAACCTTTATGAAGGATGTCGGTGTGAAGAAGT
CTCCTGGATGTGCCTGGGTTGATGTGGGGTCCGGGTTTAGACGGTTTTTAGTAGGGGGTTGTTCTGAAGAACACGGGAATGAACTTTATCCTCTGTTGGA
TGGGATGACGGAGCTGATGAAAGATGTTGGTCATGATGCTGCTGATGATGTTAGCTCGGAAGATGAAGCATTACAGACAGTGGGTTGA
AA sequence
>Lus10000043 pacid=23162263 polypeptide=Lus10000043 locus=Lus10000043.g ID=Lus10000043.BGIv1.0 annot-version=v1.0
MVEVLSACSHSGLVKEGEMLFREMFSVYDIVPRLEHYDCMVDLFGRAGMLNQAKEIVLTMPYSPTAEIWATLLGACRIHGNTDIGEWAANRLLEMKPENS
GYYVLIANMYAAAGSWDKLAKVRTFMKDVGVKKSPGCAWVDVGSGFRRFLVGGCSEEHGNELYPLLDGMTELMKDVGHDAADDVSSEDEALQTVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71490 Tetratricopeptide repeat (TPR)... Lus10000043 0 1
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10023016 17.0 0.7889
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10020016 27.4 0.7939
AT5G01720 RNI-like superfamily protein (... Lus10001264 58.0 0.7557
AT3G52860 unknown protein Lus10003357 62.2 0.7743
AT1G14300 ARM repeat superfamily protein... Lus10036742 110.4 0.7502
AT4G00440 Protein of unknown function (D... Lus10017797 117.0 0.7438
AT1G01770 unknown protein Lus10036349 158.0 0.7172
AT3G48410 alpha/beta-Hydrolases superfam... Lus10034135 158.2 0.7197
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10031022 182.3 0.7242
AT3G09850 D111/G-patch domain-containing... Lus10019584 197.0 0.7213

Lus10000043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.