Lus10000047 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47520 86 / 1e-22 AtRABA5a RAB GTPase homolog A5A (.1)
AT3G07410 53 / 3e-10 AtRABA5b RAB GTPase homolog A5B (.1)
AT2G31680 50 / 5e-09 AtRABA5d RAB GTPase homolog A5D (.1)
AT2G43130 48 / 3e-08 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G05810 48 / 4e-08 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1)
AT5G47960 45 / 5e-07 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1)
AT4G18430 45 / 5e-07 AtRABA1e RAB GTPase homolog A1E (.1)
AT3G12160 44 / 8e-07 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
AT1G07410 43 / 2e-06 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
AT5G59150 43 / 2e-06 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039052 140 / 6e-46 AT5G47520 86 / 1e-22 RAB GTPase homolog A5A (.1)
Lus10038807 130 / 4e-40 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1)
Lus10000536 98 / 3e-27 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1)
Lus10017558 98 / 4e-27 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1)
Lus10026731 51 / 3e-09 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1)
Lus10025516 51 / 3e-09 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1)
Lus10038226 49 / 2e-08 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1)
Lus10025876 49 / 2e-08 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1)
Lus10021023 47 / 1e-07 AT3G12160 384 / 3e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G010300 95 / 6e-26 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1)
Potri.006G015400 93 / 2e-25 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1)
Potri.003G004100 54 / 2e-10 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.014G150300 52 / 9e-10 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1)
Potri.002G249500 50 / 4e-09 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1)
Potri.002G231800 49 / 1e-08 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1)
Potri.006G057700 46 / 2e-07 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Potri.006G000300 44 / 1e-06 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.001G270100 44 / 1e-06 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Potri.016G050400 43 / 2e-06 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
PFAM info
Representative CDS sequence
>Lus10000047 pacid=23139991 polypeptide=Lus10000047 locus=Lus10000047.g ID=Lus10000047.BGIv1.0 annot-version=v1.0
ATGGAAACTTCTGCTCTCGACTCCTCTAACGTAGCATCAGCGTTCGAGACAGTTGTGAAGGAGATATACAACATATTGAGCAGAAAGGTGATATCCCAGG
AGCTCAAGAAACAGGAAGCCCCTGAAATGGGGAACGGAAAGACAGTGGTTTTACACAGCGATGAGGATGGCCCTGATGCAGCTAAACAAGGTGGCGGATG
TTGCTAA
AA sequence
>Lus10000047 pacid=23139991 polypeptide=Lus10000047 locus=Lus10000047.g ID=Lus10000047.BGIv1.0 annot-version=v1.0
METSALDSSNVASAFETVVKEIYNILSRKVISQELKKQEAPEMGNGKTVVLHSDEDGPDAAKQGGGCC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G47520 AtRABA5a RAB GTPase homolog A5A (.1) Lus10000047 0 1
AT3G07525 ATG10, ATATG10 autophagy 10, autophagocytosis... Lus10002145 6.2 0.7755
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10035122 7.1 0.7642
AT5G47520 AtRABA5a RAB GTPase homolog A5A (.1) Lus10039052 10.0 0.7493
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10037473 23.2 0.7465
AT5G65120 unknown protein Lus10000581 39.7 0.7252
AT1G54870 NAD(P)-binding Rossmann-fold s... Lus10033745 40.6 0.7281
AT5G16000 NIK1 NSP-interacting kinase 1 (.1) Lus10034350 43.1 0.6697
AT4G13590 Uncharacterized protein family... Lus10011763 46.1 0.7145
AT5G55760 SRT1 sirtuin 1 (.1) Lus10016619 48.8 0.7226
AT2G40435 unknown protein Lus10017415 49.8 0.7170

Lus10000047 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.