Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11905 81 / 3e-20 B-cell receptor-associated protein 31-like (.1.2) AT5G42570 71 / 2e-16 B-cell receptor-associated 31-like (.1) AT3G07190 37 / 0.0007 B-cell receptor-associated protein 31-like (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020025 [exp] 194 / 1e-64 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2) Lus10015132 [exp] 56 / 1e-10 AT5G42570 258 / 7e-88 B-cell receptor-associated 31-like (.1) Lus10031546 [exp] 52 / 3e-09 AT5G42570 287 / 3e-99 B-cell receptor-associated 31-like (.1) Lus10038188 [exp] 50 / 1e-08 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1) Lus10011842 [exp] 50 / 2e-08 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1) Lus10022777 [exp] 48 / 9e-08 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1) Lus10025914 [exp] 45 / 2e-07 AT3G07190 66 / 7e-15 B-cell receptor-associated protein 31-like (.1) Lus10035283 [exp] 41 / 4e-05 AT5G42570 244 / 9e-83 B-cell receptor-associated 31-like (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G007200 [exp] 115 / 8e-34 AT5G42570 278 / 1e-95 B-cell receptor-associated 31-like (.1) Potri.004G007900 [exp] 112 / 3e-32 AT5G42570 259 / 3e-88 B-cell receptor-associated 31-like (.1) Potri.014G154800 [exp] 62 / 5e-13 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1) Potri.014G191500 [exp] 50 / 1e-08 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1) Potri.002G245300 [exp] 48 / 7e-08 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000048 pacid=23175052 polypeptide=Lus10000048 locus=Lus10000048.g ID=Lus10000048.BGIv1.0 annot-version=v1.0 ATGAGAGAGCTTCGTATGCGGAGGAAGAACATGGATGCTCTGAGGAAGCAGACCCAGAAAAAGTCCCTGCAGGAAGAAATCACCATGCTTCGGGGCAAGC TGAAGCAGCTGGAAATTGAGATGGAAATCAAGACCAAAGAGGTCAACACTTCAGAAGTCAACGTAATTGCTTTGAAGAAGCAATCGGATGGGTTCCTGCT AGAGTATGATCGTCTACGGGACGAAAATAAGTTCTTGAGGAACAAGTTGAAGTCTCTGGATTTAAAATTCTCACGTTCAGGGAGCAAAAAGGATTCGTAA
AA sequence Show only first row Show all	>Lus10000048 pacid=23175052 polypeptide=Lus10000048 locus=Lus10000048.g ID=Lus10000048.BGIv1.0 annot-version=v1.0 MRELRMRRKNMDALRKQTQKKSLQEEITMLRGKLKQLEIEMEIKTKEVNTSEVNVIALKKQSDGFLLEYDRLRDENKFLRNKLKSLDLKFSRSGSKKDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11905			B-cell receptor-associated pro...		Lus10000048 [exp]	0	1
AT4G17960			unknown protein		Lus10000314 [exp]	2.0	0.9576
AT5G03030			Chaperone DnaJ-domain superfam...		Lus10023494 [exp]	2.2	0.9496
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10029268 [exp]	3.5	0.9506
AT3G28970		AAR3	antiauxin-resistant 3, Domain ...		Lus10030685 [exp]	4.0	0.9466
AT2G32070			Polynucleotidyl transferase, r...		Lus10018330 [exp]	4.2	0.9458
AT1G56700			Peptidase C15, pyroglutamyl pe...		Lus10001521 [exp]	4.9	0.9486
AT4G22310			Uncharacterised protein family...		Lus10023745 [exp]	5.5	0.9554
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Lus10000733 [exp]	5.5	0.9554
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10007318 [exp]	7.0	0.9484
AT1G72690			unknown protein		Lus10015607 [exp]	7.7	0.9340

Compare expression of checked genes

Lus10000048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.