Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60040 221 / 1e-67 NRPC1 nuclear RNA polymerase C1 (.1.2) AT4G35800 92 / 1e-22 RNA_POL_II_LSRNA_POL_II_LS, RNA_POL_II_LS, NRPB1 RNA polymerase II large subunit (.1) AT3G57660 87 / 6e-21 NRPA1 nuclear RNA polymerase A1 (.1) ATCG00180 62 / 3e-12 ATCG00180.1, RPOC1 DNA-directed RNA polymerase family protein (.1) AT1G63020 61 / 1e-11 SMD2, PolIVa, SDE4, NRPD1a SILENCING MOVEMENT DEFICIENT 2, NUCLEAR RNA POLYMERASE D 1A, nuclear RNA polymerase D1A (.1.2) AT2G40030 59 / 5e-11 NRPE1, DMS5, ATNRPD1B, DRD3, NRPD1b DEFECTIVE IN MERISTEM SILENCING 5, nuclear RNA polymerase D1B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013536 [exp] 246 / 2e-76 AT5G60040 1506 / 0.0 nuclear RNA polymerase C1 (.1.2) Lus10015971 [exp] 229 / 9e-71 AT5G60040 1745 / 0.0 nuclear RNA polymerase C1 (.1.2) Lus10041856 [exp] 91 / 4e-22 AT4G35800 2541 / 0.0 RNA polymerase II large subunit (.1) Lus10011299 [exp] 78 / 2e-17 AT3G57660 1801 / 0.0 nuclear RNA polymerase A1 (.1) Lus10040493 [exp] 77 / 2e-17 AT3G57660 1802 / 0.0 nuclear RNA polymerase A1 (.1) Lus10028403 [exp] 72 / 2e-15 AT4G35800 1076 / 0.0 RNA polymerase II large subunit (.1) Lus10006339 [exp] 57 / 3e-10 AT1G63020 1343 / 0.0 SILENCING MOVEMENT DEFICIENT 2, NUCLEAR RNA POLYMERASE D 1A, nuclear RNA polymerase D1A (.1.2) Lus10002748 [exp] 57 / 4e-10 AT2G40030 1773 / 0.0 DEFECTIVE IN MERISTEM SILENCING 5, nuclear RNA polymerase D1B (.1) Lus10002955 [exp] 56 / 7e-10 AT1G63020 1326 / 0.0 SILENCING MOVEMENT DEFICIENT 2, NUCLEAR RNA POLYMERASE D 1A, nuclear RNA polymerase D1A (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G341900 [exp] 214 / 2e-65 AT5G60040 1858 / 0.0 nuclear RNA polymerase C1 (.1.2) Potri.005G107600 [exp] 91 / 5e-22 AT4G35800 2836 / 0.0 RNA polymerase II large subunit (.1) Potri.006G055300 [exp] 81 / 2e-18 AT3G57660 1890 / 0.0 nuclear RNA polymerase A1 (.1) Potri.001G027232 [exp] 64 / 7e-13 AT2G40030 1596 / 0.0 DEFECTIVE IN MERISTEM SILENCING 5, nuclear RNA polymerase D1B (.1) Potri.003G196900 [exp] 57 / 4e-10 AT2G40030 1843 / 0.0 DEFECTIVE IN MERISTEM SILENCING 5, nuclear RNA polymerase D1B (.1) Potri.013G140850 [exp] 56 / 6e-10 ATCG00180 1181 / 0.0 DNA-directed RNA polymerase family protein (.1) Potri.019G028000 [exp] 54 / 2e-09 ATCG00180 516 / 0.0 DNA-directed RNA polymerase family protein (.1) Potri.001G111300 [exp] 54 / 2e-09 AT1G63020 1443 / 0.0 SILENCING MOVEMENT DEFICIENT 2, NUCLEAR RNA POLYMERASE D 1A, nuclear RNA polymerase D1A (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04983 [flax] [poplar] RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 PF00623 [flax] [poplar] RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2
Representative CDS sequence Show only first row Show all	>Lus10000051 pacid=23158766 polypeptide=Lus10000051 locus=Lus10000051.g ID=Lus10000051.BGIv1.0 annot-version=v1.0 ATGCCCTGGAGGACATTGAGATTTAACGAATCTGTTTGTAACCCATATAATGCTGATTTTGATGGTGATGAGATGAATATGCATGTCCCGCAAACAGAAG AGGCTCGTACTGAGGCTCTCACACTGATGGGGGTGCAAAACAATTTGTGCACACCAAAAAATGGAGAGATTTTGGTTGCTTCTACACAAGATTTTTTGAC GACTTCATTTCTCATTACAAGGAAGGATACCTTCTATGACCGTGCAGCATTCTCACTTATGGCAACGTATATGGGGGATGGAATGGATTCAGTGGATCTC CCCACACCTGCAATTTTGAAGGTCAGACAAGGAGAACTTGTTTCTCATCGTATTTGTTCCGAGTCTACTGTGTCATTTGCATCCTTCTTATGA
AA sequence Show only first row Show all	>Lus10000051 pacid=23158766 polypeptide=Lus10000051 locus=Lus10000051.g ID=Lus10000051.BGIv1.0 annot-version=v1.0 MPWRTLRFNESVCNPYNADFDGDEMNMHVPQTEEARTEALTLMGVQNNLCTPKNGEILVASTQDFLTTSFLITRKDTFYDRAAFSLMATYMGDGMDSVDL PTPAILKVRQGELVSHRICSESTVSFASFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60040		NRPC1	nuclear RNA polymerase C1 (.1....		Lus10000051 [exp]	0	1
AT3G04160			unknown protein		Lus10021982 [exp]	1.0	0.8967
AT1G28690			Tetratricopeptide repeat (TPR)...		Lus10015308 [exp]	2.0	0.8706
AT2G23740	C2H2ZnF	AtCZS	nucleic acid binding;sequence-...		Lus10016788 [exp]	6.2	0.8687
AT1G68930			pentatricopeptide (PPR) repeat...		Lus10037799 [exp]	6.2	0.8464
AT1G64310			Tetratricopeptide repeat (TPR)...		Lus10025624 [exp]	11.5	0.8076
AT2G02750			Pentatricopeptide repeat (PPR)...		Lus10013264 [exp]	12.7	0.8504
AT1G62680			Pentatricopeptide repeat (PPR)...		Lus10025942 [exp]	14.3	0.8162
AT1G16480			Tetratricopeptide repeat (TPR)...		Lus10017082 [exp]	19.8	0.8526
AT3G26540			Tetratricopeptide repeat (TPR)...		Lus10032922 [exp]	25.4	0.8431
AT1G27595			unknown protein		Lus10028229 [exp]	26.2	0.8595

Compare expression of checked genes

Lus10000051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.