Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62150 283 / 4e-89 ABCB21, PGP21 ATP-binding cassette B21, P-glycoprotein 21 (.1) AT2G47000 283 / 5e-89 PGP4 ,MDR4, ABCB4, ATPGP4 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) AT4G01830 282 / 5e-89 ABCB5, PGP5 ATP-binding cassette B5, P-glycoprotein 5 (.1) AT1G02520 278 / 1e-87 MDR8, ABCB11, PGP11 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) AT1G02530 270 / 1e-84 ABCB12, PGP12 ATP-binding cassette B12, P-glycoprotein 12 (.1) AT4G01820 258 / 2e-80 ABCB3, MDR3, PGP3 ATP-binding cassette B3, P-glycoprotein 3 (.1) AT4G18050 254 / 4e-79 ABCB9, PGP9 ATP-binding cassette B9, P-glycoprotein 9 (.1) AT5G46540 251 / 1e-77 ABCB7, PGP7 ATP-binding cassette B7, P-glycoprotein 7 (.1) AT1G10680 219 / 1e-66 ABCB10, PGP10 ATP-binding cassette B10, P-glycoprotein 10 (.1) AT4G25960 214 / 1e-64 ABCB2, PGP2 ATP-binding cassette B2, P-glycoprotein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010067 [exp] 332 / 8e-107 AT1G02520 1748 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10038049 [exp] 296 / 5e-94 AT3G62150 1891 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10009988 [exp] 294 / 3e-93 AT3G62150 1896 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10009989 [exp] 287 / 1e-90 AT2G47000 1754 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10038050 [exp] 286 / 2e-90 AT2G47000 1697 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10010012 [exp] 281 / 7e-89 AT1G02520 1526 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10010068 [exp] 281 / 2e-88 AT3G62150 1820 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10004519 [exp] 265 / 7e-88 AT1G02520 636 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10004530 [exp] 255 / 1e-82 AT1G02520 682 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G187500 [exp] 293 / 5e-93 AT3G62150 1860 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113500 [exp] 293 / 6e-93 AT3G62150 1879 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113200 [exp] 291 / 4e-92 AT3G62150 1871 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.010G003000 [exp] 289 / 2e-91 AT2G47000 1585 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Potri.014G113000 [exp] 283 / 4e-89 AT3G62150 1767 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.002G187400 [exp] 281 / 2e-88 AT3G62150 1702 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113100 [exp] 264 / 2e-82 AT1G02520 1773 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Potri.001G354900 [exp] 249 / 2e-77 AT4G18050 1723 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1) Potri.003G094400 [exp] 218 / 4e-66 AT4G25960 2000 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1) Potri.001G139600 [exp] 214 / 6e-65 AT4G25960 1962 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00005 [flax] [poplar] ABC_tran ABC transporter
Representative CDS sequence Show only first row Show all	>Lus10000052 pacid=23139735 polypeptide=Lus10000052 locus=Lus10000052.g ID=Lus10000052.BGIv1.0 annot-version=v1.0 ATGGGTCTGGTGGGGCAAGAACCCTCATTGTTCAACGACACAATCAGAGCAAACATTGCATATGGGAAAGAAGGGAATGCAAGTGAGGCAGAGATCATAG CTGCATCAAAGCTGGCCAATGCACACAGATTCATCAGCGGATTACAACACGGCTATGATACGATTGTTGGGGAGCGTGGAATCCAGTTGTCAGGAGGACA GAAGCAAAGGGTAGCCATTGCTCGAGCAATCGTGAAAGAACCAAAGATATTGCTGTTGGACGAGGCAACCAGTGCGCTTGATGCCGAGTCTGAAAGAGTG GTACAGGATGCATTGGATCAAGTGATGGTGAACAGAACAACGATCGTGGTAGCTCACCGACTTTCGACTGTTAAGAATGCAGATCTGATCGCGGTGGTGA AAAATGGAGTGATTGTAGAAAAGGGCAAGCATGAAATATTGATGAATCTTAGAGATGGTGTCTACGCTTCATTGCTGGCTCTTCATAAAACTGCTACAAC TTCTTAG
AA sequence Show only first row Show all	>Lus10000052 pacid=23139735 polypeptide=Lus10000052 locus=Lus10000052.g ID=Lus10000052.BGIv1.0 annot-version=v1.0 MGLVGQEPSLFNDTIRANIAYGKEGNASEAEIIAASKLANAHRFISGLQHGYDTIVGERGIQLSGGQKQRVAIARAIVKEPKILLLDEATSALDAESERV VQDALDQVMVNRTTIVVAHRLSTVKNADLIAVVKNGVIVEKGKHEILMNLRDGVYASLLALHKTATTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62150		ABCB21, PGP21	ATP-binding cassette B21, P-gl...		Lus10000052 [exp]	0	1
AT4G30600			signal recognition particle re...		Lus10035066 [exp]	1.0	0.9830
AT1G30620		MURUS4, HSR8, U...	UDP-D-XYLOSE 4-EPIMERASE 1, MU...		Lus10013107 [exp]	2.6	0.9682
AT1G49670		NQR	ARP protein (REF) (.1), ARP pr...		Lus10027904 [exp]	2.8	0.9723
AT5G16120			alpha/beta-Hydrolases superfam...		Lus10009169 [exp]	3.0	0.9720
AT4G05390		ATRFNR1	root FNR 1 (.1.2)		Lus10023266 [exp]	3.5	0.9684
AT1G07160			Protein phosphatase 2C family ...		Lus10041072 [exp]	3.5	0.9698
AT3G51660			Tautomerase/MIF superfamily pr...		Lus10000344 [exp]	5.2	0.9527
AT5G03700			D-mannose binding lectin prote...		Lus10014371 [exp]	5.3	0.9610
AT2G31570		ATGPX2	glutathione peroxidase 2 (.1)		Lus10027021 [exp]	5.5	0.9592
AT4G18360			Aldolase-type TIM barrel famil...		Lus10023302 [exp]	5.7	0.9680

Compare expression of checked genes

Lus10000052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.