Lus10000053 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71980 131 / 4e-37 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
AT4G09560 115 / 7e-31 NHL22 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
AT1G35630 112 / 1e-30 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
AT1G22670 93 / 8e-23 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
AT5G66160 79 / 2e-18 JR700, ATRMR1 ARABIDOPSIS THALIANA RECEPTOR HOMOLOGY REGION TRANSMEMBRANE DOMAIN RING H2 MOTIF PROTEIN 1, receptor homology region transmembrane domain ring H2 motif protein 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006074 219 / 1e-70 AT1G71980 466 / 2e-162 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
Lus10014823 147 / 5e-42 AT1G71980 488 / 3e-168 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
Lus10016936 143 / 1e-41 AT1G71980 483 / 1e-169 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
Lus10041896 88 / 2e-21 AT5G66160 283 / 3e-94 ARABIDOPSIS THALIANA RECEPTOR HOMOLOGY REGION TRANSMEMBRANE DOMAIN RING H2 MOTIF PROTEIN 1, receptor homology region transmembrane domain ring H2 motif protein 1 (.1.2)
Lus10028443 88 / 3e-21 AT5G66160 286 / 6e-96 ARABIDOPSIS THALIANA RECEPTOR HOMOLOGY REGION TRANSMEMBRANE DOMAIN RING H2 MOTIF PROTEIN 1, receptor homology region transmembrane domain ring H2 motif protein 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G082500 135 / 1e-38 AT1G71980 449 / 3e-156 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
Potri.013G111500 128 / 1e-35 AT1G71980 427 / 5e-147 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
Potri.005G111100 84 / 4e-20 AT5G66160 264 / 3e-88 ARABIDOPSIS THALIANA RECEPTOR HOMOLOGY REGION TRANSMEMBRANE DOMAIN RING H2 MOTIF PROTEIN 1, receptor homology region transmembrane domain ring H2 motif protein 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0364 Leu-IlvD PF02225 PA PA domain
Representative CDS sequence
>Lus10000053 pacid=23141657 polypeptide=Lus10000053 locus=Lus10000053.g ID=Lus10000053.BGIv1.0 annot-version=v1.0
ATGGCAAAATCCGAGCTTCTTCTTCTTCTTCTGGGTTTGTTAGCTTGTTCTTGCTGTTTCTTCATCACCTCCGCCACTGTCGTTCTGATGGGGGATAACG
TCACCATGTCCTTCGACGACATCGAAGCCAATTTCGTGGTGCCAGTGAAGGGTGCTGGTGAATGTGGAATGTTGTACGTAGCTGAGCCACTGGATGCTTG
CTCAAAATTGAGTAATGAAGTTATTAATAGAGATGAGAATAATTCTTCTACTGCTAGCTCTTCGCCGTTTGTGCTGATTGTTAGAGGAGGAGGGTGTAGC
TTTGAGGATAAAGTTAGAAGAGCTCAGGCAGCTGGGTTTCGAGCTGCGATCGTTTACGATGATGAAGATGGTGGCTTACTTGTTGCAACTGAGTTTCACC
ATGAACATGCTTCATATTCGTGTGATGTTCCAACTTCGGCTTGA
AA sequence
>Lus10000053 pacid=23141657 polypeptide=Lus10000053 locus=Lus10000053.g ID=Lus10000053.BGIv1.0 annot-version=v1.0
MAKSELLLLLLGLLACSCCFFITSATVVLMGDNVTMSFDDIEANFVVPVKGAGECGMLYVAEPLDACSKLSNEVINRDENNSSTASSSPFVLIVRGGGCS
FEDKVRRAQAAGFRAAIVYDDEDGGLLVATEFHHEHASYSCDVPTSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71980 Protease-associated (PA) RING/... Lus10000053 0 1
AT1G71980 Protease-associated (PA) RING/... Lus10009438 1.0 0.9556
AT1G06290 ATACX3, ACX3 acyl-CoA oxidase 3 (.1) Lus10002177 2.4 0.9094
AT3G56950 SIP2;1, SIP2 small and basic intrinsic prot... Lus10027275 7.9 0.7826
Lus10013898 10.5 0.8884
AT3G48360 ATBT2, BT2 BTB and TAZ domain protein 2 (... Lus10013670 10.6 0.8886
AT3G04590 AT-hook AT hook motif DNA-binding fami... Lus10006572 10.7 0.8253
AT2G39210 Major facilitator superfamily ... Lus10021512 11.0 0.8959
AT5G63160 BT1 BTB and TAZ domain protein 1 (... Lus10033038 15.3 0.8875
AT2G29970 Double Clp-N motif-containing ... Lus10036183 16.8 0.8088
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10010373 17.1 0.8872

Lus10000053 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.