Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37470 192 / 7e-63 alpha/beta-Hydrolases superfamily protein (.1) AT3G03990 137 / 4e-41 alpha/beta-Hydrolases superfamily protein (.1) AT3G24420 91 / 3e-23 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037651 [exp] 243 / 2e-82 AT4G37470 414 / 1e-147 alpha/beta-Hydrolases superfamily protein (.1) Lus10014859 [exp] 219 / 2e-73 AT4G37470 442 / 5e-159 alpha/beta-Hydrolases superfamily protein (.1) Lus10019303 [exp] 201 / 5e-66 AT4G37470 433 / 4e-155 alpha/beta-Hydrolases superfamily protein (.1) Lus10018686 [exp] 137 / 5e-41 AT3G03990 448 / 4e-161 alpha/beta-Hydrolases superfamily protein (.1) Lus10007737 [exp] 115 / 3e-32 AT3G03990 227 / 2e-73 alpha/beta-Hydrolases superfamily protein (.1) Lus10010398 [exp] 113 / 6e-32 AT4G37470 335 / 1e-116 alpha/beta-Hydrolases superfamily protein (.1) Lus10033087 [exp] 97 / 2e-25 AT3G24420 281 / 3e-95 alpha/beta-Hydrolases superfamily protein (.1) Lus10013541 [exp] 90 / 1e-22 AT3G03990 234 / 7e-77 alpha/beta-Hydrolases superfamily protein (.1) Lus10017296 [exp] 85 / 9e-21 AT3G03990 232 / 7e-76 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G052000 [exp] 210 / 8e-70 AT4G37470 451 / 3e-162 alpha/beta-Hydrolases superfamily protein (.1) Potri.005G145000 [exp] 204 / 1e-67 AT4G37470 468 / 7e-169 alpha/beta-Hydrolases superfamily protein (.1) Potri.014G016500 [exp] 144 / 6e-44 AT3G03990 434 / 1e-155 alpha/beta-Hydrolases superfamily protein (.1) Potri.002G118900 [exp] 141 / 9e-43 AT3G03990 440 / 4e-158 alpha/beta-Hydrolases superfamily protein (.1) Potri.016G062700 [exp] 101 / 4e-27 AT3G24420 253 / 3e-84 alpha/beta-Hydrolases superfamily protein (.1) Potri.006G155500 [exp] 91 / 5e-23 AT3G24420 331 / 8e-115 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000054 pacid=23158590 polypeptide=Lus10000054 locus=Lus10000054.g ID=Lus10000054.BGIv1.0 annot-version=v1.0 ATGCAGTCGAATTACAAATCATGGTGCGGTGGATTCGCGCCGTTGATCGTCGGCGGGGACATGGATTCGCCGGCGGTGCAGGAATTCTGCCGGACGCTGT TCAACATGCGGCCGGACATAGCTCTGCGGATCGCGCAGGTTGCGTTCCAGAGCGACATGAGGAGCATTCTTCACATGGTCACCGTCCCCTGCCACATCGT GCAGAGCGCGAAGGACTCGGCGGTTCCGGTGGCGGTTTCGGAGTATCTGCACCGTCATCTTGGAGGGGAGTCCATAGTCGAGGTCATGCCGATTGAAGGC CACCTTCCACAGCTCAGCTCGCCCGACGTTGTGGCTCCGGTGCTGCTCCGGCATATTCGTAGCAATATCGGTCACCAGTAA
AA sequence Show only first row Show all	>Lus10000054 pacid=23158590 polypeptide=Lus10000054 locus=Lus10000054.g ID=Lus10000054.BGIv1.0 annot-version=v1.0 MQSNYKSWCGGFAPLIVGGDMDSPAVQEFCRTLFNMRPDIALRIAQVAFQSDMRSILHMVTVPCHIVQSAKDSAVPVAVSEYLHRHLGGESIVEVMPIEG HLPQLSSPDVVAPVLLRHIRSNIGHQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37470			alpha/beta-Hydrolases superfam...		Lus10000054 [exp]	0	1
AT4G37470			alpha/beta-Hydrolases superfam...		Lus10015633 [exp]	12.1	0.9114
AT2G42360			RING/U-box superfamily protein...		Lus10005105 [exp]	12.4	0.9445
					Lus10024872 [exp]	18.3	0.9428
AT2G42350			RING/U-box superfamily protein...		Lus10005104 [exp]	19.1	0.9377
AT2G38870			Serine protease inhibitor, pot...		Lus10018786 [exp]	25.4	0.9383
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10025901 [exp]	31.4	0.9381
AT3G11840		PUB24	plant U-box 24 (.1)		Lus10004191 [exp]	36.0	0.9371
AT1G06135			unknown protein		Lus10000703 [exp]	41.0	0.9368
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021455 [exp]	41.2	0.9353
AT3G09520		ATEXO70H4	exocyst subunit exo70 family p...		Lus10024438 [exp]	41.4	0.9372

Compare expression of checked genes

Lus10000054 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.