Lus10000056 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42680 100 / 2e-29 MBF1A, ATMBF1A ARABIDOPSIS THALIANA MULTIPROTEIN BRIDGING FACTOR 1A, multiprotein bridging factor 1A (.1)
AT3G58680 97 / 7e-28 MBF1B, ATMBF1B multiprotein bridging factor 1B (.1)
AT3G24500 73 / 2e-18 MBF1C, ATMBF1C multiprotein bridging factor 1C (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013686 111 / 2e-33 AT3G58680 224 / 5e-77 multiprotein bridging factor 1B (.1)
Lus10017945 111 / 2e-33 AT3G58680 224 / 5e-77 multiprotein bridging factor 1B (.1)
Lus10021776 71 / 2e-17 AT3G24500 202 / 8e-68 multiprotein bridging factor 1C (.1.2)
Lus10034592 71 / 2e-17 AT3G24500 201 / 1e-67 multiprotein bridging factor 1C (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G390400 107 / 3e-32 AT3G58680 242 / 6e-84 multiprotein bridging factor 1B (.1)
Potri.011G109500 107 / 5e-32 AT3G58680 240 / 3e-83 multiprotein bridging factor 1B (.1)
Potri.018G075200 80 / 3e-21 AT3G24500 223 / 4e-76 multiprotein bridging factor 1C (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF01381 HTH_3 Helix-turn-helix
Representative CDS sequence
>Lus10000056 pacid=23149790 polypeptide=Lus10000056 locus=Lus10000056.g ID=Lus10000056.BGIv1.0 annot-version=v1.0
ATGCAAGGTCGGATGGATAAGAAGCTTACCCAGTCTCAACTTGCTCAGCTCATCAACGAGAAGCCTCAGATAATACAAGAGTACGAGTCCGGAAAAGCCA
TTCCCAACCAGCAGATTATAGGCAAGTTAGAGAGAGCTCTTGGAGTGAAGCTGCGAGGTAAGAAGTGA
AA sequence
>Lus10000056 pacid=23149790 polypeptide=Lus10000056 locus=Lus10000056.g ID=Lus10000056.BGIv1.0 annot-version=v1.0
MQGRMDKKLTQSQLAQLINEKPQIIQEYESGKAIPNQQIIGKLERALGVKLRGKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42680 MBF1A, ATMBF1A ARABIDOPSIS THALIANA MULTIPROT... Lus10000056 0 1
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10000920 1.4 0.9117
AT1G11760 MED32 unknown protein Lus10034758 1.4 0.8966
AT3G18510 unknown protein Lus10032475 1.7 0.8898
AT5G51510 unknown protein Lus10027200 4.0 0.8894
AT1G04290 Thioesterase superfamily prote... Lus10004288 4.5 0.8871
AT1G67620 Lojap-related protein (.1) Lus10015822 4.5 0.8798
AT4G00530 unknown protein Lus10037854 5.7 0.8741
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Lus10030583 5.7 0.8835
AT4G08460 Protein of unknown function (D... Lus10024758 6.9 0.8435
AT3G06610 DNA-binding enhancer protein-r... Lus10037773 7.3 0.8807

Lus10000056 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.