Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32220 166 / 3e-52 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G10730 74 / 1e-16 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G15910 66 / 8e-14 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010419 [exp] 221 / 9e-73 AT1G32220 397 / 5e-139 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10012126 [exp] 211 / 2e-71 AT1G32220 241 / 3e-81 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10020108 [exp] 73 / 3e-16 AT5G10730 427 / 5e-152 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10035719 [exp] 69 / 7e-15 AT5G10730 271 / 9e-91 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10037306 [exp] 40 / 0.0001 AT5G10730 151 / 7e-45 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G136900 [exp] 184 / 5e-59 AT1G32220 328 / 8e-113 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.018G013400 [exp] 76 / 3e-17 AT5G10730 422 / 2e-150 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.004G106300 [exp] 76 / 3e-17 AT5G10730 360 / 1e-125 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.006G268000 [exp] 75 / 7e-17 AT5G10730 431 / 1e-153 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000057 pacid=23145589 polypeptide=Lus10000057 locus=Lus10000057.g ID=Lus10000057.BGIv1.0 annot-version=v1.0 ATGATATCAGTCCATGACTACAACCTCCCATCATTCCTTCTCCAATCTGGGTACTTCACCGGGAAAAGGAAAGCCGAATCGGAGGTCCTCTCCAAATATC CAAGCTCAAGCGTCATTCTGAGGCCGGGTTTCATCTATGGGAAGAGAAGAGTGAACGGGTTCGAGATACCACTGGACGCAGTAGGGCAGCCATTGGAGAA GATTCTTGAAGCTGTTAGCAACTTCACCAGACCCCTGAGTGCTCTTCCAGCGTCCGATTTGTTGCTCGCGCCTCCAGTTAGTGTCGATGATGTTGCGCTT GCCGTGATCAATGCAGTTGGGGATGACGATGTTTTTGGGGTGCTCAGCATTGAACAGATCAAGGAAGCTGCTGCTAAAGTCAAGATATGA
AA sequence Show only first row Show all	>Lus10000057 pacid=23145589 polypeptide=Lus10000057 locus=Lus10000057.g ID=Lus10000057.BGIv1.0 annot-version=v1.0 MISVHDYNLPSFLLQSGYFTGKRKAESEVLSKYPSSSVILRPGFIYGKRRVNGFEIPLDAVGQPLEKILEAVSNFTRPLSALPASDLLLAPPVSVDDVAL AVINAVGDDDVFGVLSIEQIKEAAAKVKI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32220			NAD(P)-binding Rossmann-fold s...		Lus10000057 [exp]	0	1
AT5G19940			Plastid-lipid associated prote...		Lus10042448 [exp]	1.0	0.9191
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10028073 [exp]	5.7	0.9112
AT1G32220			NAD(P)-binding Rossmann-fold s...		Lus10010419 [exp]	6.9	0.8775
AT5G38510			Rhomboid-related intramembrane...		Lus10000628 [exp]	9.7	0.8843
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10016820 [exp]	9.9	0.9055
AT1G03910			unknown protein		Lus10030000 [exp]	14.4	0.8146
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10033034 [exp]	15.5	0.8926
AT2G04842		EMB2761	EMBRYO DEFECTIVE 2761, threony...		Lus10006406 [exp]	16.5	0.8431
AT1G69550			disease resistance protein (TI...		Lus10005807 [exp]	16.7	0.7945
AT1G27340			Galactose oxidase/kelch repeat...		Lus10003117 [exp]	16.9	0.8336

Compare expression of checked genes

Lus10000057 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.