Lus10000058 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G46910 112 / 7e-32 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036340 136 / 9e-42 AT2G46910 325 / 6e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10010277 95 / 2e-25 AT2G46910 266 / 5e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10035384 38 / 0.0004 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10030987 37 / 0.0005 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G183700 109 / 5e-31 AT2G46910 366 / 2e-128 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Lus10000058 pacid=23149315 polypeptide=Lus10000058 locus=Lus10000058.g ID=Lus10000058.BGIv1.0 annot-version=v1.0
ATGATTGTTTTTTTGTGGCAGGTAAACTTGGAAGGATGCAACAGTGGTTCTCCAATCGACCTGTTGCTGCTAGATGGAACTTGGCGCCTGCAGTATACTT
CTGCCTCTGATGCCCTCGTGCTTTTCGAGGCTGCCGCAAAGCTTCCTTTCTTCCAGGTTGGGCAGATATTTCAAAAATTCGAGTGTCGGGATCGGTCTGA
TGGTGGTGTCATTCGTAATGGAGTGTTCCTTCATTGTTGGAGGTGA
AA sequence
>Lus10000058 pacid=23149315 polypeptide=Lus10000058 locus=Lus10000058.g ID=Lus10000058.BGIv1.0 annot-version=v1.0
MIVFLWQVNLEGCNSGSPIDLLLLDGTWRLQYTSASDALVLFEAAAKLPFFQVGQIFQKFECRDRSDGGVIRNGVFLHCWR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G46910 Plastid-lipid associated prote... Lus10000058 0 1
AT3G21690 MATE efflux family protein (.1... Lus10002067 7.8 0.7816
AT5G57670 Protein kinase superfamily pro... Lus10015516 10.2 0.7745
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Lus10002108 14.7 0.7542
AT3G50310 MKKK20, MAPKKK2... MAPKK kinase 20, mitogen-activ... Lus10029047 16.1 0.6940
AT2G48150 ATGPX4 glutathione peroxidase 4 (.1) Lus10042692 32.5 0.7536
AT1G33970 P-loop containing nucleoside t... Lus10009482 33.2 0.7479
Lus10040989 33.5 0.6832
AT5G62360 Plant invertase/pectin methyle... Lus10038915 34.5 0.7362
AT2G46910 Plastid-lipid associated prote... Lus10010277 38.6 0.7369
AT5G05690 CBB3, DWF3, CYP... DWARF 3, CYTOCHROME P450 90A1,... Lus10014850 51.1 0.7322

Lus10000058 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.