Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41685 81 / 8e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) AT1G64220 78 / 1e-20 TOM7-2 translocase of outer membrane 7 kDa subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016473 [exp] 103 / 5e-31 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10040758 [exp] 103 / 9e-31 AT5G41685 88 / 7e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10001641 [exp] 92 / 2e-26 AT5G41685 85 / 1e-23 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10007843 [exp] 89 / 3e-25 AT5G41685 85 / 5e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10004754 [exp] 86 / 4e-24 AT5G41685 81 / 3e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G146602 [exp] 76 / 3e-20 AT5G41685 78 / 9e-21 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.006G077500 [exp] 76 / 7e-20 AT5G41685 75 / 1e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.018G145502 [exp] 72 / 1e-18 AT5G41685 74 / 2e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08038 [flax] [poplar] Tom7 TOM7 family
Representative CDS sequence Show only first row Show all	>Lus10000059 pacid=23182469 polypeptide=Lus10000059 locus=Lus10000059.g ID=Lus10000059.BGIv1.0 annot-version=v1.0 ATGGCGTCTAGGGTTTCGCTGAGGACGAAAGGGTCGAAGAGCAGCAAGAAAGGCAAACGCAGTGACGAGAAATCGAGGACGGAGAGCTTGAAGGAGTGGA CAGATTGGAGCTTGCACAAGGCCAAAGTCGCCGTTCACTATGGCTTCATCCCTCTCATCATTTACATCGGCATGAACTCTGAACCAAAACCTCAGCTGTA CCAGCTCCTCAGCCCCGTCTGA
AA sequence Show only first row Show all	>Lus10000059 pacid=23182469 polypeptide=Lus10000059 locus=Lus10000059.g ID=Lus10000059.BGIv1.0 annot-version=v1.0 MASRVSLRTKGSKSSKKGKRSDEKSRTESLKEWTDWSLHKAKVAVHYGFIPLIIYIGMNSEPKPQLYQLLSPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41685			Mitochondrial outer membrane t...		Lus10000059 [exp]	0	1
AT5G41685			Mitochondrial outer membrane t...		Lus10040758 [exp]	2.4	0.8677
AT5G59850			Ribosomal protein S8 family pr...		Lus10023429 [exp]	13.1	0.8663
AT4G26500		SUFE1, EMB1374,...	SULFUR E 1, MBRYO DEFECTIVE 13...		Lus10026101 [exp]	20.6	0.8605
AT2G47640			Small nuclear ribonucleoprotei...		Lus10026556 [exp]	23.3	0.8545
AT5G52370			unknown protein		Lus10016449 [exp]	26.5	0.8517
AT1G60770			Tetratricopeptide repeat (TPR)...		Lus10029115 [exp]	28.3	0.8439
AT1G61010		CPSF73-I	cleavage and polyadenylation s...		Lus10001372 [exp]	35.0	0.8183
AT2G03590		ATUPS1	ureide permease 1 (.1)		Lus10037074 [exp]	36.8	0.8515
					Lus10029394 [exp]	39.2	0.8246
AT3G06700			Ribosomal L29e protein family ...		Lus10037740 [exp]	41.9	0.8450

Compare expression of checked genes

Lus10000059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.