Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04360 142 / 1e-40 ATPU1 ,ATLDA PULLULANASE 1, limit dextrinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037943 [exp] 219 / 6e-71 AT5G04360 402 / 6e-131 PULLULANASE 1, limit dextrinase (.1) Lus10038675 [exp] 207 / 8e-64 AT5G04360 1200 / 0.0 PULLULANASE 1, limit dextrinase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G229300 [exp] 150 / 3e-43 AT5G04360 1399 / 0.0 PULLULANASE 1, limit dextrinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0369 [flax] [poplar] GHD PF11852 [flax] [poplar] DUF3372 Domain of unknown function (DUF3372)
Representative CDS sequence Show only first row Show all	>Lus10000060 pacid=23172392 polypeptide=Lus10000060 locus=Lus10000060.g ID=Lus10000060.BGIv1.0 annot-version=v1.0 ATGGAAACACAGGAACGGGTGCGATTCCACAATGTTGGTCCTTCTTCAGTAGCTGGCGTTATAGTGATGAGCATTGAAGATGGTCATGCTGCCAAACCCG ATTTACCTCAGCTAGATCAGACCTACTCCTGCATTGTAGTAATCTACAATGCTCAACCATGTGAGATATCATTTACCGACCCAGGTCTACAAGCCAGGAA TTTCCGGCTCCATCCCGTTCAGGTGAAGACTAGTGATGAAGTGGTGAAGAAATCATCATATGATGCATCCTCAGGATGCTTCACTATACCGTCGAGGACA GCATCTGTGTTTGTGGAGTGTCGGTGA
AA sequence Show only first row Show all	>Lus10000060 pacid=23172392 polypeptide=Lus10000060 locus=Lus10000060.g ID=Lus10000060.BGIv1.0 annot-version=v1.0 METQERVRFHNVGPSSVAGVIVMSIEDGHAAKPDLPQLDQTYSCIVVIYNAQPCEISFTDPGLQARNFRLHPVQVKTSDEVVKKSSYDASSGCFTIPSRT ASVFVECR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04360		ATPU1 ,ATLDA	PULLULANASE 1, limit dextrinas...		Lus10000060 [exp]	0	1
AT5G22930			Protein of unknown function (D...		Lus10037944 [exp]	3.7	0.7813
AT4G38190		ATCSLD4	ARABIDOPSIS THALIANA CELLULOSE...		Lus10001619 [exp]	4.2	0.7638
AT2G28880		ADCS, EMB1997	embryo defective 1997, aminode...		Lus10041403 [exp]	5.2	0.8095
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10035705 [exp]	14.1	0.7358
AT5G51920			Pyridoxal phosphate (PLP)-depe...		Lus10006342 [exp]	16.1	0.7411
					Lus10028745 [exp]	28.1	0.6935
AT3G26700			Protein kinase superfamily pro...		Lus10012585 [exp]	29.7	0.7039
					Lus10017544 [exp]	30.4	0.7291
AT5G63180			Pectin lyase-like superfamily ...		Lus10033037 [exp]	34.6	0.7370
AT2G47240		CER8, LACS1	LONG-CHAIN ACYL-COA SYNTHASE 1...		Lus10032840 [exp]	35.0	0.7535

Compare expression of checked genes

Lus10000060 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.