Lus10000062 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60820 232 / 6e-79 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015867 282 / 1e-98 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10009294 220 / 7e-68 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Lus10004024 186 / 7e-61 AT3G60820 190 / 4e-61 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10030272 93 / 5e-26 AT3G60820 81 / 2e-20 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G148300 240 / 5e-82 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.014G069800 236 / 2e-80 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.002G080800 47 / 5e-07 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1)
Potri.005G180500 45 / 2e-06 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Lus10000062 pacid=23154277 polypeptide=Lus10000062 locus=Lus10000062.g ID=Lus10000062.BGIv1.0 annot-version=v1.0
ATGAGCTGTTCTGCTATGGGTCAACTACTCTCTAACACCCTCTACTACAAACGTTTCTTCCCTTACTACACCTTTAATATTCTGGGTGGCCTCGACAATG
AAGGCAAGGGATGTGTTTACACGTATGATGCTGTTGGTTCCTATGAGATGGTGGGGTACAGCTCCCAGGGTTCTGGTTCTAAACTGATCATGCCTTTCCT
TGACAACCAGTTGAAGTCTCCAAGCCCTCTATTAGAGCCAGCGCAGGATGCTGTGACTCCACTTTCTGAGTCTGAAGCAATTGATTTAGTGAAAACTTGT
TTTGCTTCTGCAACCGAGAGGGACATACACACTGGAGACAAGCTTGAAATAGTTGTGCTCAATGGTGATGGCATTCGTCGTGAATTTATGGAGTTGAGAA
AGGACTAG
AA sequence
>Lus10000062 pacid=23154277 polypeptide=Lus10000062 locus=Lus10000062.g ID=Lus10000062.BGIv1.0 annot-version=v1.0
MSCSAMGQLLSNTLYYKRFFPYYTFNILGGLDNEGKGCVYTYDAVGSYEMVGYSSQGSGSKLIMPFLDNQLKSPSPLLEPAQDAVTPLSESEAIDLVKTC
FASATERDIHTGDKLEIVVLNGDGIRREFMELRKD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10000062 0 1
AT1G15370 SNARE-like superfamily protein... Lus10002911 5.4 0.7627
AT2G20280 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10023164 7.3 0.7355
AT5G14240 Thioredoxin superfamily protei... Lus10032064 8.6 0.7625
AT3G42150 unknown protein Lus10011614 9.4 0.7182
Lus10008962 10.4 0.7059
AT1G07960 ATPDIL5-1 PDI-like 5-1 (.1.2.3) Lus10011641 11.1 0.7477
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Lus10030294 13.1 0.7472
AT5G54750 Transport protein particle (TR... Lus10028720 15.8 0.7444
AT5G55640 unknown protein Lus10043162 21.7 0.7069
AT5G49060 Heat shock protein DnaJ, N-ter... Lus10037502 22.8 0.7018

Lus10000062 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.