Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23140 126 / 1e-37 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT1G66670 64 / 2e-13 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT5G45390 61 / 3e-12 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G11750 60 / 7e-12 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT1G02560 60 / 8e-12 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) ATCG00670 59 / 1e-11 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT4G17040 56 / 1e-10 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G12410 56 / 3e-10 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT1G09130 52 / 4e-09 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013435 [exp] 182 / 3e-58 AT5G23140 209 / 5e-66 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 176 / 2e-56 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10013434 [exp] 146 / 1e-44 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 145 / 1e-44 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 120 / 5e-35 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10017397 [exp] 119 / 1e-34 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10028905 [exp] 53 / 3e-09 AT1G12410 268 / 5e-90 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Lus10004319 [exp] 52 / 6e-09 AT1G12410 239 / 7e-79 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Lus10011282 [exp] 50 / 2e-08 AT1G11750 300 / 2e-102 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G092600 [exp] 125 / 3e-37 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.007G071700 [exp] 126 / 5e-37 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.004G152900 [exp] 64 / 2e-13 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.004G092100 [exp] 63 / 7e-13 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.002G195200 [exp] 62 / 2e-12 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 62 / 2e-12 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.003G103300 [exp] 61 / 3e-12 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.009G114001 [exp] 61 / 4e-12 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.003G083300 [exp] 54 / 1e-09 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1) Potri.001G115900 [exp] 53 / 2e-09 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [flax] [poplar] ClpP_crotonase PF00574 [flax] [poplar] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Lus10000063 pacid=23142521 polypeptide=Lus10000063 locus=Lus10000063.g ID=Lus10000063.BGIv1.0 annot-version=v1.0 ATGATTCATCAACCATCTGGAGGGTACGAAGGGCAAGCCCAGGATATGAGGATCCACACACAGCATATAATTCGCGTTTGGGATAGTCTGAATGAGCTGT ACGCAAAGCATACAGGGCAGCCAATAGATATAATCGCCAAGAACATGGACAGGGATAATTACATGAACCCTGATGAGGCTAAGGATTTCGGCCTCATTGA CGAAGTGGCCGAACCTAAGGCAATTGATTTGGTTACCGGTACATTTGGTGGCCAAGGAAGGGTAACAGGAGGAGGAGGAGGGTCGGAGCCGAGTCAGGAG GTTTCGACCGAATGA
AA sequence Show only first row Show all	>Lus10000063 pacid=23142521 polypeptide=Lus10000063 locus=Lus10000063.g ID=Lus10000063.BGIv1.0 annot-version=v1.0 MIHQPSGGYEGQAQDMRIHTQHIIRVWDSLNELYAKHTGQPIDIIAKNMDRDNYMNPDEAKDFGLIDEVAEPKAIDLVTGTFGGQGRVTGGGGGSEPSQE VSTE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10000063 [exp]	0	1
AT4G37380			Tetratricopeptide repeat (TPR)...		Lus10000110 [exp]	4.2	0.9187
AT4G17600		LIL3:1	Chlorophyll A-B binding family...		Lus10000959 [exp]	4.5	0.9194
AT2G27680			NAD(P)-linked oxidoreductase s...		Lus10006267 [exp]	4.9	0.9051
AT4G20360		AtRab8D, AtRABE...	RAB GTPase homolog E1B (.1)		Lus10019493 [exp]	9.0	0.9139
AT5G46580			pentatricopeptide (PPR) repeat...		Lus10000897 [exp]	11.3	0.9098
AT5G13510		EMB3136	EMBRYO DEFECTIVE 3136, Ribosom...		Lus10001982 [exp]	11.5	0.9065
AT5G57170			Tautomerase/MIF superfamily pr...		Lus10033324 [exp]	15.3	0.8711
AT5G06290		2CPB, 2-CysPrxB...	2-CYS PEROXIREDOXIN B, 2-cyste...		Lus10021295 [exp]	16.6	0.9007
AT4G33030		SQD1	sulfoquinovosyldiacylglycerol ...		Lus10013513 [exp]	18.0	0.8683
AT5G54190		PORA	protochlorophyllide oxidoreduc...		Lus10018579 [exp]	18.5	0.9076

Compare expression of checked genes

Lus10000063 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.