Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12000 320 / 2e-105 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G26150 314 / 4e-103 protein kinase family protein (.1) AT2G24370 291 / 2e-93 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT4G31230 273 / 8e-87 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G78940 263 / 6e-84 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) AT1G16760 264 / 2e-83 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G17540 260 / 4e-82 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G72760 257 / 3e-81 Protein kinase superfamily protein (.1) AT2G07020 254 / 6e-80 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G35380 249 / 6e-78 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026439 [exp] 389 / 2e-133 AT5G12000 662 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10020185 [exp] 298 / 1e-98 AT2G24370 741 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10027593 [exp] 291 / 4e-96 AT2G24370 665 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10040573 [exp] 297 / 7e-96 AT2G24370 815 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10021596 [exp] 296 / 2e-95 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10008542 [exp] 295 / 4e-95 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10026989 [exp] 292 / 1e-93 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10024212 [exp] 286 / 2e-91 AT2G24370 780 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10035712 [exp] 278 / 7e-91 AT1G16760 624 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G225300 [exp] 345 / 2e-114 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G061600 [exp] 340 / 1e-112 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.006G078500 [exp] 303 / 6e-99 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G002400 [exp] 290 / 2e-93 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.001G198300 [exp] 280 / 6e-89 AT5G12000 639 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.007G001900 [exp] 266 / 4e-84 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.014G001700 [exp] 253 / 5e-79 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.004G170742 [exp] 234 / 3e-72 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.006G147000 [exp] 202 / 2e-60 AT5G57035 674 / 0.0 U-box domain-containing protein kinase family protein (.1) Potri.004G233000 [exp] 199 / 6e-59 AT4G25160 874 / 0.0 U-box domain-containing protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10000068 pacid=23161998 polypeptide=Lus10000068 locus=Lus10000068.g ID=Lus10000068.BGIv1.0 annot-version=v1.0 ATGGAAGCAGCTGAGAAAACTAAAAAACTAGCAGAAATGGAGGCACAAAAGAGAAAGTTCGCAAAGATGAAAGCGAAAAAAGAGGCAGATGCTAAGAATC GTACATTAGATGCTTTAACAAAAAATGACGTACGTTACAAGAAATATACTATTGAAGAGATTGAAGCAGCTACTGAAAAGTTCAAACAATCATTCAAGAT AGGTGAAGGTGGTTATGGACCTGTGTACAAAGTGTATGAATACTTGGAAAATGGAAGTTTAGAAGATAGGTTGCTTAGAAAAGACAACACCTCACCTATA CCTTGGAGAAGGCGATTTGATATAGCTGCTGAGATTGCTGCTGGACTTCTTTTCCTACACCAAGCAAAGCTAGAGCCACTAGTTCACAAGGATCTTAAAC CAGCTCATATCCTCTTGGATGGCAACTATGTTAGCAAGATTAGTGACGCAGGACTAGCACGACTAGTCCCTCCATCAGTTGCTGATAGTGTTACTCAATA CTATATGACTTCAGCTACCGGAACCTTTTGCTATATATATCCTGAGTATCAACAAACAGGGATGTTAACTACTAGATCAGATGTCTACTCCTTTGGTATA ATGCTACTCCAAATTATCACTGCCAAGCCCCCAATAGGTTTGGCTCACCATGTGGCAAGGGCAATTGACAAGGGAGAGTTTATAGATATGCTTGCTCAAT CCATTGTCGGCTGGCCTCTAGATCATTCTTTGGAATTTTGCTAA
AA sequence Show only first row Show all	>Lus10000068 pacid=23161998 polypeptide=Lus10000068 locus=Lus10000068.g ID=Lus10000068.BGIv1.0 annot-version=v1.0 MEAAEKTKKLAEMEAQKRKFAKMKAKKEADAKNRTLDALTKNDVRYKKYTIEEIEAATEKFKQSFKIGEGGYGPVYKVYEYLENGSLEDRLLRKDNTSPI PWRRRFDIAAEIAAGLLFLHQAKLEPLVHKDLKPAHILLDGNYVSKISDAGLARLVPPSVADSVTQYYMTSATGTFCYIYPEYQQTGMLTTRSDVYSFGI MLLQIITAKPPIGLAHHVARAIDKGEFIDMLAQSIVGWPLDHSLEFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G26150			protein kinase family protein ...		Lus10000068 [exp]	0	1
AT1G63060			unknown protein		Lus10000001 [exp]	8.2
AT5G35110			unknown protein		Lus10000078 [exp]	72.4
AT2G38540		ATLTP1, LP1	ARABIDOPSIS THALIANA LIPID TRA...		Lus10000082 [exp]	74.2
AT2G46490			unknown protein		Lus10000088 [exp]	76.9
AT4G09160			SEC14 cytosolic factor family ...		Lus10000102 [exp]	82.9
AT1G60780		HAP13	HAPLESS 13, Clathrin adaptor c...		Lus10000107 [exp]	84.9
					Lus10000109 [exp]	85.7
AT3G07565			Protein of unknown function (D...		Lus10000123 [exp]	91.1
					Lus10000134 [exp]	95.1
AT5G17490	GRAS	AtRGL3, RGL3	RGA-like protein 3 (.1)		Lus10000140 [exp]	97.2

Compare expression of checked genes

Lus10000068 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.