Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24318 73 / 9e-17 O-Glycosyl hydrolases family 17 protein (.1.2) AT1G32860 65 / 9e-14 Glycosyl hydrolase superfamily protein (.1) AT3G46570 64 / 1e-13 Glycosyl hydrolase superfamily protein (.1) AT3G55430 64 / 2e-13 O-Glycosyl hydrolases family 17 protein (.1) AT3G15800 64 / 3e-13 Glycosyl hydrolase superfamily protein (.1) AT2G39640 62 / 9e-13 glycosyl hydrolase family 17 protein (.1) AT4G29360 58 / 3e-11 O-Glycosyl hydrolases family 17 protein (.1.2) AT5G55180 57 / 3e-11 O-Glycosyl hydrolases family 17 protein (.1.2) AT5G56590 57 / 4e-11 O-Glycosyl hydrolases family 17 protein (.1) AT3G23770 57 / 4e-11 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021088 [exp] 149 / 1e-45 AT5G24318 324 / 3e-108 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10005459 [exp] 106 / 2e-29 AT5G24318 341 / 3e-115 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10004962 [exp] 106 / 1e-28 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10040808 [exp] 90 / 1e-22 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10016539 [exp] 90 / 1e-22 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10023245 [exp] 73 / 1e-16 AT5G24318 561 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10008865 [exp] 71 / 6e-16 AT5G24318 517 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10005166 [exp] 69 / 3e-15 AT5G24318 385 / 1e-129 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10004869 [exp] 68 / 6e-15 AT2G27500 491 / 5e-174 Glycosyl hydrolase superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G240000 [exp] 77 / 6e-18 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.008G056000 [exp] 76 / 1e-17 AT3G55430 494 / 1e-173 O-Glycosyl hydrolases family 17 protein (.1) Potri.015G010100 [exp] 76 / 1e-17 AT5G24318 466 / 1e-163 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.012G017800 [exp] 73 / 1e-16 AT5G24318 583 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.018G068600 [exp] 61 / 2e-12 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.009G163700 [exp] 61 / 2e-12 AT2G27500 499 / 1e-177 Glycosyl hydrolase superfamily protein (.1.2.3) Potri.003G032600 [exp] 59 / 8e-12 AT3G15800 524 / 0.0 Glycosyl hydrolase superfamily protein (.1) Potri.014G158400 [exp] 59 / 1e-11 AT2G05790 751 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.008G055900 [exp] 58 / 2e-11 AT3G55430 494 / 8e-174 O-Glycosyl hydrolases family 17 protein (.1) Potri.001G192200 [exp] 58 / 2e-11 AT3G15800 514 / 0.0 Glycosyl hydrolase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00332 [flax] [poplar] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Lus10000070 pacid=23172435 polypeptide=Lus10000070 locus=Lus10000070.g ID=Lus10000070.BGIv1.0 annot-version=v1.0 ATGTCTGAAATCGACCCAGCCGCCCAGACCTTTGAATCCCCTGCTCTCCGCAAGCTGCTGGAGTTCCACCTCCGTACCAGGACTCCGTTCATGGTGAATC CGTACCCGTTCCTCAAGGTCTGGGGCGGGTACCCGGATCTGGATTACGCGGTTTTCAGGGAGAACAAAGGGGTGTTGGATAAGGCTACTGGGAAGATGTA TACGAACATGCTGGACGAGATGCTGGATGCGGTTTATGTTTCGATGAAGAAGCTGGATTAG
AA sequence Show only first row Show all	>Lus10000070 pacid=23172435 polypeptide=Lus10000070 locus=Lus10000070.g ID=Lus10000070.BGIv1.0 annot-version=v1.0 MSEIDPAAQTFESPALRKLLEFHLRTRTPFMVNPYPFLKVWGGYPDLDYAVFRENKGVLDKATGKMYTNMLDEMLDAVYVSMKKLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46570			Glycosyl hydrolase superfamily...		Lus10000070 [exp]	0	1
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10001493 [exp]	1.0	0.9010
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	5.8	0.8872
					Lus10024012 [exp]	6.9	0.8058
AT4G30030			Eukaryotic aspartyl protease f...		Lus10031450 [exp]	7.1	0.8626
AT5G52850			Pentatricopeptide repeat (PPR)...		Lus10038834 [exp]	7.7	0.7725
AT5G50170			C2 calcium/lipid-binding and G...		Lus10015665 [exp]	8.5	0.7661
AT2G47770		ATTSPO	TSPO(outer membrane tryptophan...		Lus10037513 [exp]	9.2	0.6877
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10039454 [exp]	10.8	0.8622
AT1G11410			S-locus lectin protein kinase ...		Lus10007610 [exp]	11.7	0.7805
AT4G26830			O-Glycosyl hydrolases family 1...		Lus10011852 [exp]	11.9	0.7196

Compare expression of checked genes

Lus10000070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.