Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73430 118 / 2e-32 sec34-like family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015940 [exp] 175 / 2e-52 AT1G73430 1319 / 0.0 sec34-like family protein (.1.2) Lus10001792 [exp] 122 / 2e-34 AT1G73430 720 / 0.0 sec34-like family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G138900 [exp] 147 / 1e-42 AT1G73430 1316 / 0.0 sec34-like family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000075 pacid=23161333 polypeptide=Lus10000075 locus=Lus10000075.g ID=Lus10000075.BGIv1.0 annot-version=v1.0 ATGGCGGCGAAAGGAACTCAACCGAACATGCACAAATCCGTTGCAATTTGTAAGGGATACAACTTTGCTTCTACCTGGGAACAGAATGCTCCTCTTACTG AGCAACAGCAAGCCGCGATTCTTTCACTCTCTCGTGCTGTTGCGGAGCGGCCGTATCCTGCCAATTTGTCCCAAGATCATACCCCAAGTCTAGAGAATGG TGGCTTGACTGTATCTACCGAGGACAGTGCGCGGGGAGAGACTCAAGCTATTGAAGCTGTTTTAGTCAATACAAATCAAGTACGTTCTTCTATCAGAATT TACACTTAA
AA sequence Show only first row Show all	>Lus10000075 pacid=23161333 polypeptide=Lus10000075 locus=Lus10000075.g ID=Lus10000075.BGIv1.0 annot-version=v1.0 MAAKGTQPNMHKSVAICKGYNFASTWEQNAPLTEQQQAAILSLSRAVAERPYPANLSQDHTPSLENGGLTVSTEDSARGETQAIEAVLVNTNQVRSSIRI YT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73430			sec34-like family protein (.1....		Lus10000075 [exp]	0	1
AT3G07100		AtSEC24A, SEC24...	ENDOPLASMIC RETICULUM MORPHOLO...		Lus10016597 [exp]	9.9	0.8792
AT1G73430			sec34-like family protein (.1....		Lus10001792 [exp]	10.2	0.8316
AT2G19600		ATKEA4	K+ efflux antiporter 4, K+ eff...		Lus10007999 [exp]	16.4	0.8312
AT3G10380		SEC8, ATSEC8	subunit of exocyst complex 8 (...		Lus10038694 [exp]	17.1	0.8658
AT3G10380		SEC8, ATSEC8	subunit of exocyst complex 8 (...		Lus10037962 [exp]	17.3	0.8624
AT5G13530		KEG	KEEP ON GOING, protein kinases...		Lus10024135 [exp]	18.8	0.8680
AT1G52260		ATPDI3, ATPDIL1...	ARABIDOPSIS THALIANA PROTEIN D...		Lus10035870 [exp]	19.5	0.7654
AT5G16210			HEAT repeat-containing protein...		Lus10028491 [exp]	25.1	0.8460
AT3G63460		EMB2221	transducin family protein / WD...		Lus10019751 [exp]	26.0	0.8598
AT2G31660		EMA1, URM9, SAD...	UNARMED 9, SUPER SENSITIVE TO ...		Lus10026726 [exp]	26.2	0.8587

Compare expression of checked genes

Lus10000075 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.