Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03230 103 / 7e-27 Eukaryotic aspartyl protease family protein (.1) AT1G03220 102 / 2e-26 Eukaryotic aspartyl protease family protein (.1) AT5G19120 51 / 2e-08 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041225 [exp] 246 / 2e-82 AT1G03220 369 / 2e-125 Eukaryotic aspartyl protease family protein (.1) Lus10021936 [exp] 158 / 2e-47 AT1G03220 536 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10041224 [exp] 142 / 3e-41 AT1G03220 527 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10021938 [exp] 118 / 3e-32 AT1G03220 501 / 3e-176 Eukaryotic aspartyl protease family protein (.1) Lus10041223 [exp] 117 / 3e-32 AT1G03220 525 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10041226 [exp] 89 / 8e-22 AT1G03220 382 / 1e-130 Eukaryotic aspartyl protease family protein (.1) Lus10036343 [exp] 81 / 1e-18 AT1G03220 469 / 2e-164 Eukaryotic aspartyl protease family protein (.1) Lus10034036 [exp] 71 / 5e-15 AT1G03220 316 / 1e-103 Eukaryotic aspartyl protease family protein (.1) Lus10010278 [exp] 70 / 6e-15 AT1G03220 259 / 1e-83 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G203200 [exp] 117 / 3e-32 AT1G03220 509 / 6e-180 Eukaryotic aspartyl protease family protein (.1) Potri.002G054900 [exp] 111 / 6e-30 AT1G03220 544 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.006G068900 [exp] 111 / 7e-30 AT1G03220 456 / 5e-159 Eukaryotic aspartyl protease family protein (.1) Potri.019G065000 [exp] 57 / 3e-10 AT1G03220 309 / 3e-101 Eukaryotic aspartyl protease family protein (.1) Potri.019G065100 [exp] 56 / 4e-10 AT1G03220 298 / 5e-97 Eukaryotic aspartyl protease family protein (.1) Potri.019G064800 [exp] 56 / 5e-10 AT1G03230 290 / 1e-93 Eukaryotic aspartyl protease family protein (.1) Potri.001G240600 [exp] 56 / 5e-10 AT1G03230 293 / 4e-95 Eukaryotic aspartyl protease family protein (.1) Potri.019G065200 [exp] 56 / 5e-10 AT1G03230 303 / 4e-99 Eukaryotic aspartyl protease family protein (.1) Potri.005G095600 [exp] 54 / 2e-09 AT1G03220 322 / 3e-106 Eukaryotic aspartyl protease family protein (.1) Potri.008G203100 [exp] 52 / 1e-08 AT1G03220 280 / 3e-90 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000080 pacid=23176137 polypeptide=Lus10000080 locus=Lus10000080.g ID=Lus10000080.BGIv1.0 annot-version=v1.0 ATGGCTCTTGGTTGTAGCTGCATTTTCCTTGTCTCAATTTCTTGTCTTCTGTTCTCCATCACAACATCTGAAGCACAATCATCATTCAAGCCTAAAGCAC TCGTCCTTCCACTTTCCAAAGACCCATCAACTCTCCAACACATTACCCAAATCAACCAAAGAACCCCTCTCGTCCCAGTCAAGCTAACTGTTGATCTTGG TGGGAAGTACCTCTGGGTTGACTGTGAACAAGGCTATGTCTCATCATCCTACAAGCCTGCTCGCTGCGGATCGGGCAATGCTCACTTGCAAAGTCAAGGA CCTGCAGCAACAATACCTGTGAACTTTTGCCTGACAACACGGTCACACGCACTGTTAGCGTCGGAGCCCTTGGCCAGGATGTTGTAA
AA sequence Show only first row Show all	>Lus10000080 pacid=23176137 polypeptide=Lus10000080 locus=Lus10000080.g ID=Lus10000080.BGIv1.0 annot-version=v1.0 MALGCSCIFLVSISCLLFSITTSEAQSSFKPKALVLPLSKDPSTLQHITQINQRTPLVPVKLTVDLGGKYLWVDCEQGYVSSSYKPARCGSGNAHLQSQG PAATIPVNFCLTTRSHALLASEPLARML

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G03230			Eukaryotic aspartyl protease f...		Lus10000080 [exp]	0	1
AT1G03220			Eukaryotic aspartyl protease f...		Lus10041225 [exp]	1.0	0.9595
AT5G39670			Calcium-binding EF-hand family...		Lus10012199 [exp]	8.0	0.8337
AT1G23420	YABBY	INO, YAB4	INNER NO OUTER, Plant-specific...		Lus10030596 [exp]	8.8	0.8421
					Lus10022721 [exp]	9.0	0.8406
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10034098 [exp]	9.5	0.7906
AT1G14220			Ribonuclease T2 family protein...		Lus10027978 [exp]	11.3	0.8371
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10010939 [exp]	13.4	0.8368
AT2G34930			disease resistance family prot...		Lus10006945 [exp]	15.6	0.8289
AT5G10530			Concanavalin A-like lectin pro...		Lus10033782 [exp]	16.3	0.7964
					Lus10026392 [exp]	21.7	0.7551

Compare expression of checked genes

Lus10000080 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.