Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38540 85 / 3e-22 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G01870 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 79 / 8e-20 LTP6 lipid transfer protein 6 (.1.2) AT5G59310 76 / 7e-19 LTP4 lipid transfer protein 4 (.1) AT5G59320 75 / 2e-18 LTP3 lipid transfer protein 3 (.1) AT2G38530 70 / 3e-16 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT3G51600 67 / 3e-15 LTP5 lipid transfer protein 5 (.1) AT3G51590 67 / 3e-15 LTP12 lipid transfer protein 12 (.1) AT2G15050 61 / 6e-13 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT2G18370 61 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022744 [exp] 187 / 1e-62 AT2G38540 86 / 1e-22 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Lus10025230 [exp] 117 / 2e-34 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10025148 [exp] 115 / 4e-34 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10015279 [exp] 81 / 1e-20 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10025231 [exp] 81 / 1e-20 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10025151 [exp] 76 / 1e-18 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10014167 [exp] 73 / 1e-17 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10015278 [exp] 72 / 3e-17 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10022745 [exp] 72 / 5e-17 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 94 / 6e-26 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 92 / 4e-25 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 86 / 1e-22 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 84 / 7e-22 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 76 / 1e-18 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 76 / 1e-18 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 75 / 3e-18 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G135400 [exp] 71 / 1e-16 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 70 / 2e-16 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.009G025200 [exp] 62 / 3e-13 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10000082 pacid=23180233 polypeptide=Lus10000082 locus=Lus10000082.g ID=Lus10000082.BGIv1.0 annot-version=v1.0 ATGGCGAACTCTGCTTCACCATCTTCCATGGCTATGATCATACCAATGCTGCTCATCGTGGCACTAACAATGATGACGATGACAATGCATTCCTCGGCCA CGATAAGCTGCGGCCAGGTGCTCATCAGGCTGGCCCCATGCATTCCCTACGTCCAGAACGGCGGCGACCATATACCAGTTGCTTGCTGCAAAGGGGTAAC GTCGTTGAACGATGCTGCCGTTACCACACCCGACCGTCAGGGAGTTTGTAACTGCATCGTAACTGCCGCTCGGGGTTTGAAGTACAATGATTACAGCCTT CGACTCGCCGCTGGACTCCCAGATGGCTGCGGTCTGGTTGATTTTCATTACAAGATCAATCCCTCCATCAACTGTTCCACGTAA
AA sequence Show only first row Show all	>Lus10000082 pacid=23180233 polypeptide=Lus10000082 locus=Lus10000082.g ID=Lus10000082.BGIv1.0 annot-version=v1.0 MANSASPSSMAMIIPMLLIVALTMMTMTMHSSATISCGQVLIRLAPCIPYVQNGGDHIPVACCKGVTSLNDAAVTTPDRQGVCNCIVTAARGLKYNDYSL RLAAGLPDGCGLVDFHYKINPSINCST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38540		ATLTP1, LP1	ARABIDOPSIS THALIANA LIPID TRA...		Lus10000082 [exp]	0	1
AT1G63060			unknown protein		Lus10000001 [exp]	9.0
AT5G26150			protein kinase family protein ...		Lus10000068 [exp]	74.2
AT5G35110			unknown protein		Lus10000078 [exp]	79.5
AT2G46490			unknown protein		Lus10000088 [exp]	84.5
AT4G09160			SEC14 cytosolic factor family ...		Lus10000102 [exp]	91.0
AT1G60780		HAP13	HAPLESS 13, Clathrin adaptor c...		Lus10000107 [exp]	93.2
					Lus10000109 [exp]	94.1
AT3G07565			Protein of unknown function (D...		Lus10000123 [exp]	100.0
					Lus10000134 [exp]	104.4
AT5G17490	GRAS	AtRGL3, RGL3	RGA-like protein 3 (.1)		Lus10000140 [exp]	106.8

Compare expression of checked genes

Lus10000082 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.