Lus10000083 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64720 99 / 2e-24 CP5 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G14500 67 / 4e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT5G54170 62 / 2e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G23080 61 / 8e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033247 199 / 2e-62 AT1G64720 523 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10032938 74 / 2e-15 AT1G64720 437 / 2e-152 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008281 72 / 4e-15 AT1G64720 374 / 1e-130 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10021883 63 / 2e-11 AT4G14500 605 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10041166 62 / 4e-11 AT4G14500 607 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G151500 123 / 4e-33 AT1G64720 515 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.001G450100 104 / 2e-26 AT1G64720 489 / 6e-173 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.015G005000 100 / 1e-24 AT1G64720 474 / 1e-166 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.012G021400 99 / 3e-24 AT1G64720 478 / 2e-168 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G162600 62 / 4e-11 AT4G14500 581 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.010G076500 56 / 2e-09 AT4G14500 571 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10000083 pacid=23166967 polypeptide=Lus10000083 locus=Lus10000083.g ID=Lus10000083.BGIv1.0 annot-version=v1.0
ATGGCTTTGTGGTCACTCTTACTTGACATTCTCCAACGCCCCAAGCTTCTCGATGTCCTCGCTGAGCTCTCCATCTTAGCTGCTCCTCTCTGGATTGCCG
TCGTCGTCGGCGTTCTCGTTGGCTGGTCCTGGAAGCCTAAGTGGGCTGTTCTCTCCGCTCCGCAATCTCCGGCTTCTTCTTTCTCAAGCTTCAAGCTTCA
GCTCCCCACCAGCTTCATTCCATGGGTTTCCAGCAACGATTTGAATCAAATCCACTCATCCTCTGCCGCTTCCCCGCCTACCCTGTCTTCTGACTCAAGT
TCCGGGAAGGGGAAAACGAGTATTGTATCAACGGATGATTTGGAGTACTTGTCTAAGCTTGTTGAAGTCAAAGATGGAGGCCCTGCTTGGATTCAGATGA
TGGACCGTTCTACCCCCACCATGACCTACCAAGCTTGGAGAAGGGATCTTCAGTTTCCTTTCTTCTGTAGCGACAGAGAGTACATCATTGGCCGCCGGAT
TTGGGAGTCCGACAGAACATACTACTGTGTCACCAAGGTATTTGGAACTCCTCTGGTTTCTGTTTATACGGTATTACCATGTTTAGCCTATGCGTTTAAC
TTCCAATTACAAAAGGACTAG
AA sequence
>Lus10000083 pacid=23166967 polypeptide=Lus10000083 locus=Lus10000083.g ID=Lus10000083.BGIv1.0 annot-version=v1.0
MALWSLLLDILQRPKLLDVLAELSILAAPLWIAVVVGVLVGWSWKPKWAVLSAPQSPASSFSSFKLQLPTSFIPWVSSNDLNQIHSSSAASPPTLSSDSS
SGKGKTSIVSTDDLEYLSKLVEVKDGGPAWIQMMDRSTPTMTYQAWRRDLQFPFFCSDREYIIGRRIWESDRTYYCVTKVFGTPLVSVYTVLPCLAYAFN
FQLQKD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23080 Polyketide cyclase/dehydrase a... Lus10000083 0 1
AT4G02790 EMB3129 EMBRYO DEFECTIVE 3129, GTP-bin... Lus10006927 2.2 0.8963
AT4G30825 Tetratricopeptide repeat (TPR)... Lus10035818 2.8 0.8782
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Lus10008281 4.9 0.8438
AT5G08520 MYB Duplicated homeodomain-like su... Lus10041001 10.7 0.8178
AT5G08520 MYB Duplicated homeodomain-like su... Lus10013447 12.0 0.8377
AT1G09900 Pentatricopeptide repeat (PPR-... Lus10031564 13.2 0.8625
AT5G36170 ATPRFB, HCF109 high chlorophyll fluorescent 1... Lus10041119 15.9 0.8422
AT2G36000 EMB3114 EMBRYO DEFECTIVE 3114, Mitocho... Lus10004219 16.0 0.8199
AT2G36000 EMB3114 EMBRYO DEFECTIVE 3114, Mitocho... Lus10029422 22.4 0.8167
AT1G22700 Tetratricopeptide repeat (TPR)... Lus10041265 22.9 0.8523

Lus10000083 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.