Lus10000092 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36945 188 / 3e-58 PLC-like phosphodiesterases superfamily protein (.1)
AT3G19310 178 / 3e-54 PLC-like phosphodiesterases superfamily protein (.1)
AT1G49740 168 / 3e-51 PLC-like phosphodiesterases superfamily protein (.1)
AT5G67130 155 / 1e-45 PLC-like phosphodiesterases superfamily protein (.1)
AT1G13680 147 / 6e-43 PLC-like phosphodiesterases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019339 293 / 1e-98 AT4G36945 462 / 1e-161 PLC-like phosphodiesterases superfamily protein (.1)
Lus10041594 182 / 1e-59 AT1G49740 122 / 1e-34 PLC-like phosphodiesterases superfamily protein (.1)
Lus10019843 179 / 1e-54 AT1G49740 524 / 0.0 PLC-like phosphodiesterases superfamily protein (.1)
Lus10014072 179 / 2e-54 AT1G49740 522 / 0.0 PLC-like phosphodiesterases superfamily protein (.1)
Lus10012600 162 / 2e-48 AT1G13680 440 / 5e-155 PLC-like phosphodiesterases superfamily protein (.1)
Lus10035130 158 / 6e-47 AT1G13680 437 / 7e-154 PLC-like phosphodiesterases superfamily protein (.1)
Lus10031973 155 / 2e-46 AT1G13680 435 / 1e-153 PLC-like phosphodiesterases superfamily protein (.1)
Lus10009368 155 / 2e-45 AT5G67130 580 / 0.0 PLC-like phosphodiesterases superfamily protein (.1)
Lus10000649 141 / 2e-40 AT1G13680 435 / 4e-153 PLC-like phosphodiesterases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G139400 244 / 4e-80 AT4G36945 505 / 4e-179 PLC-like phosphodiesterases superfamily protein (.1)
Potri.007G045200 237 / 3e-77 AT4G36945 520 / 0.0 PLC-like phosphodiesterases superfamily protein (.1)
Potri.004G140200 205 / 7e-65 AT1G49740 548 / 0.0 PLC-like phosphodiesterases superfamily protein (.1)
Potri.017G098900 160 / 4e-48 AT1G13680 450 / 3e-159 PLC-like phosphodiesterases superfamily protein (.1)
Potri.011G144900 157 / 1e-46 AT1G13680 462 / 2e-163 PLC-like phosphodiesterases superfamily protein (.1)
Potri.007G045700 157 / 2e-46 AT5G67130 591 / 0.0 PLC-like phosphodiesterases superfamily protein (.1)
Potri.004G117500 154 / 3e-45 AT1G13680 447 / 8e-158 PLC-like phosphodiesterases superfamily protein (.1)
Potri.005G140100 150 / 2e-43 AT5G67130 572 / 0.0 PLC-like phosphodiesterases superfamily protein (.1)
Potri.009G100332 55 / 3e-09 AT1G49740 341 / 9e-118 PLC-like phosphodiesterases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10000092 pacid=23174295 polypeptide=Lus10000092 locus=Lus10000092.g ID=Lus10000092.BGIv1.0 annot-version=v1.0
ATGGTGAAAAAGAATCAACGGCTTTTGGTCTTCTCCTCCAAAGCCGAGAAAGAGGCTTCTGAAGGGTTTGCATATACATGGAGATATGTATTGGAAACTC
AGTATGGAGACGACGGGATGAAACCTGATTCATGCAAGAACCGAAACGAATCACCTCCTCTCAACATAACTACGATATCGTTGATTCTAGAAAACTTCTT
CCCAACTAATCCAAACAACTCTCGAGTCTGCATGGAGAACTCACTTCCACTGCAAGAAGCAACTAAATCATGTGCTAAGGCAGCTGGGAACCGGTGGGCG
AACTTCATTGCTGTCGATTTCTATCAGAGAAGTGATGGTGGTGGAGCCCCAGAAGCAGTGAATGAAGCGAATGGTCACCTCACCTGTGGGTGTCCAAATA
TTGCCTACTGCAAGTTCAATGCTACATTTGGGACATGTGATGTACCACAACTAGCCCCACCTCCACCTGCTGCTGGAGGAGAACAAACTTTGTTTGGTCC
TGACAGTGCTTACTCTGAAAGAAGCCAAATCCAACTAGGATGGCTGCTGGGAACATTTTTTATCATCAAACTGCTCTTACATTTCTGA
AA sequence
>Lus10000092 pacid=23174295 polypeptide=Lus10000092 locus=Lus10000092.g ID=Lus10000092.BGIv1.0 annot-version=v1.0
MVKKNQRLLVFSSKAEKEASEGFAYTWRYVLETQYGDDGMKPDSCKNRNESPPLNITTISLILENFFPTNPNNSRVCMENSLPLQEATKSCAKAAGNRWA
NFIAVDFYQRSDGGGAPEAVNEANGHLTCGCPNIAYCKFNATFGTCDVPQLAPPPPAAGGEQTLFGPDSAYSERSQIQLGWLLGTFFIIKLLLHF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36945 PLC-like phosphodiesterases su... Lus10000092 0 1
AT4G24290 MAC/Perforin domain-containing... Lus10010894 1.4 0.9490
AT5G53330 Ubiquitin-associated/translati... Lus10038829 2.0 0.9339
AT5G54310 NEV, AGD5 NEVERSHED, ARF-GAP domain 5 (.... Lus10011238 4.0 0.8929
AT2G31390 STH pfkB-like carbohydrate kinase ... Lus10009526 4.6 0.9244
AT5G35200 ENTH/ANTH/VHS superfamily prot... Lus10038122 5.9 0.9210
AT1G21380 Target of Myb protein 1 (.1) Lus10029739 6.0 0.9205
AT5G16880 Target of Myb protein 1 (.1.2.... Lus10005924 6.7 0.9066
AT1G14780 MAC/Perforin domain-containing... Lus10037426 9.5 0.8848
AT2G02960 RING/FYVE/PHD zinc finger supe... Lus10037172 11.5 0.8979
AT2G22250 ATAAT, AAT, MEE... MATERNAL EFFECT EMBRYO ARREST ... Lus10032388 13.0 0.8922

Lus10000092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.