Lus10000093 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37660 114 / 9e-33 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT3G06040 87 / 9e-22 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
AT1G70190 86 / 3e-21 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
AT4G36420 77 / 4e-18 Ribosomal protein L12 family protein (.1)
AT2G03130 52 / 5e-09 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT3G27850 48 / 5e-07 RPL12-C ribosomal protein L12-C (.1)
AT3G27830 48 / 6e-07 RPL12-A ribosomal protein L12-A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023839 234 / 2e-79 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10021011 227 / 1e-76 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10041783 92 / 9e-24 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1)
Lus10028336 92 / 1e-23 AT4G36420 176 / 1e-56 Ribosomal protein L12 family protein (.1)
Lus10036228 91 / 9e-23 AT1G70190 238 / 3e-80 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10038367 91 / 1e-22 AT1G70190 243 / 3e-82 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10031756 85 / 1e-20 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10031180 84 / 1e-20 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10013078 52 / 3e-08 AT3G27830 175 / 7e-56 ribosomal protein L12-A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G224300 140 / 1e-42 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Potri.015G077200 91 / 4e-23 AT3G06040 132 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Potri.007G019100 87 / 2e-21 AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1)
Potri.003G074800 86 / 7e-21 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Potri.001G346100 46 / 2e-06 AT3G27830 146 / 1e-44 ribosomal protein L12-A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
Representative CDS sequence
>Lus10000093 pacid=23172722 polypeptide=Lus10000093 locus=Lus10000093.g ID=Lus10000093.BGIv1.0 annot-version=v1.0
ATGGCTGCAATCTCCTCAAAATTGCCTCCTAAATCCCTGACAAACCTCTTGAATTTGGGCCGAATCTCCCGCCACCTATCCGCCACCGCCAGTTCCGCAG
CTCCCTCCTCCGACGCCCGGATTCAGAAGCTCGAACGCATCGCCGATGAACTCATCGACCTCACTAAGCTCGAGCGCTACGATTACTCCATCCTCTTCCG
CTTCAAAATGGGCCTCAACCGCTACGGCCCTGCTATTTCCGGAACCATATCCTCAGGTCCCGGCGCCGCAGCCGCCGGATCCAGCGGCGCAGATGCCAAG
CCCGCGGAGAAGACGGCGTTCAACATCAAGCTGGAGAAGTACGACGCTGCGGCGAAGATCAAGATTATAAAGGAAGTTAGATCGTTTACCGATTTGGGGC
TGAAGGAGGCCAAGGATTTGGTGGAGAAAGTGCCTGCGGTTCTGAAGAAAGGGATTACTAAAGAGGAGGCAACTCCCATTCTTGAGAAGCTCAAGGAATT
GGGAGCTACTGTGGTATTGGAATGA
AA sequence
>Lus10000093 pacid=23172722 polypeptide=Lus10000093 locus=Lus10000093.g ID=Lus10000093.BGIv1.0 annot-version=v1.0
MAAISSKLPPKSLTNLLNLGRISRHLSATASSAAPSSDARIQKLERIADELIDLTKLERYDYSILFRFKMGLNRYGPAISGTISSGPGAAAAGSSGADAK
PAEKTAFNIKLEKYDAAAKIKIIKEVRSFTDLGLKEAKDLVEKVPAVLKKGITKEEATPILEKLKELGATVVLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37660 Ribosomal protein L12/ ATP-dep... Lus10000093 0 1
AT4G37660 Ribosomal protein L12/ ATP-dep... Lus10023839 1.0 0.9598
AT3G02660 EMB2768 EMBRYO DEFECTIVE 2768, Tyrosyl... Lus10039064 4.0 0.8756
AT3G25580 Thioredoxin superfamily protei... Lus10013889 8.9 0.8373
AT2G17265 DMR1, HSK DOWNY MILDEW RESISTANT 1, homo... Lus10022990 9.0 0.8476
AT3G48560 TZP5, IMR1, ALS... TRIAZOLOPYRIMIDINE RESISTANT 5... Lus10022446 10.2 0.8194
AT4G34340 TAF8 TBP-associated factor 8 (.1) Lus10026530 10.4 0.8277
AT3G62660 GATL7 galacturonosyltransferase-like... Lus10010025 13.8 0.8161
AT1G26761 Arabinanase/levansucrase/inver... Lus10037153 14.1 0.8318
AT3G52750 FTSZ2-2 Tubulin/FtsZ family protein (.... Lus10014196 15.1 0.8104
AT4G29240 Leucine-rich repeat (LRR) fami... Lus10012929 16.7 0.8035

Lus10000093 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.