Lus10000095 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02080 220 / 5e-75 Ribosomal protein S19e family protein (.1)
AT5G61170 217 / 1e-73 Ribosomal protein S19e family protein (.1)
AT5G15520 214 / 1e-72 Ribosomal protein S19e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010339 313 / 9e-112 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1)
Lus10013188 239 / 3e-82 AT3G02080 259 / 2e-90 Ribosomal protein S19e family protein (.1)
Lus10021865 237 / 5e-82 AT3G02080 216 / 7e-74 Ribosomal protein S19e family protein (.1)
Lus10030702 235 / 4e-81 AT3G02080 215 / 2e-73 Ribosomal protein S19e family protein (.1)
Lus10032992 234 / 6e-81 AT3G02080 218 / 1e-74 Ribosomal protein S19e family protein (.1)
Lus10033532 230 / 7e-79 AT3G02080 258 / 3e-90 Ribosomal protein S19e family protein (.1)
Lus10020836 229 / 2e-78 AT3G02080 258 / 5e-90 Ribosomal protein S19e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G056100 217 / 9e-74 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
Potri.004G118800 216 / 3e-73 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
Potri.017G092200 214 / 1e-72 AT5G61170 270 / 5e-95 Ribosomal protein S19e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF01090 Ribosomal_S19e Ribosomal protein S19e
Representative CDS sequence
>Lus10000095 pacid=23161920 polypeptide=Lus10000095 locus=Lus10000095.g ID=Lus10000095.BGIv1.0 annot-version=v1.0
ATGGATTCGCTTTCGGACAAGGTCAGATTCCGGACTTGGGTTTGCACCAAATGGGATCCGCGATCTAAGCCCAGCATTGTTGTAGCCGGACCGGGCAAGG
AAAACATAAAGATAGAGCTTCCCCCATGGACTGATATTGTGAAGACTGGGAAGTTGAAGGAGCTTGCACCTTACGACCCTGACTGGTATTACATCAGAGC
TGCCTCAATGGCGAGAAAGGTATACCTTAGAGGCGGCCTTGGTGTTGGTGCATTCCGGAGAATTTATGGCGGGAGCAAAAGGAATGGAAGCCGCCCGCCC
CATTTCTGCAAAAGCAGTGGTGCTGTCGCCCGTCACATTCTTCAACAATTGGAGAAGGTTAACATCGTTGAAGTTGATACCAACGGTGGAAGGAAGATTA
CTTCAAATGGCCAGAGGGATTTGGATCAAGTTGCTGGACGGGTTATTGTTGTTGCTCCTTGA
AA sequence
>Lus10000095 pacid=23161920 polypeptide=Lus10000095 locus=Lus10000095.g ID=Lus10000095.BGIv1.0 annot-version=v1.0
MDSLSDKVRFRTWVCTKWDPRSKPSIVVAGPGKENIKIELPPWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPP
HFCKSSGAVARHILQQLEKVNIVEVDTNGGRKITSNGQRDLDQVAGRVIVVAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02080 Ribosomal protein S19e family ... Lus10000095 0 1
AT3G02080 Ribosomal protein S19e family ... Lus10010339 1.4 0.9148
AT4G25740 RNA binding Plectin/S10 domain... Lus10027519 2.0 0.8856
AT5G23710 DNA binding;DNA-directed RNA p... Lus10009479 5.5 0.8407
AT3G02080 Ribosomal protein S19e family ... Lus10021865 12.0 0.8735
AT5G39850 Ribosomal protein S4 (.1) Lus10042193 14.5 0.8277
AT3G13580 Ribosomal protein L30/L7 famil... Lus10021296 15.7 0.8303
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10031974 20.1 0.8176
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10041264 22.1 0.8692
AT5G54580 RNA-binding (RRM/RBD/RNP motif... Lus10014802 22.4 0.7721
AT4G14320 Zinc-binding ribosomal protein... Lus10017396 26.4 0.8520

Lus10000095 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.