Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02390 120 / 2e-33 ATPARP1, APP POLY\(ADP-RIBOSE\) POLYMERASE 1, poly(ADP-ribose) polymerase (.1) AT2G31320 69 / 2e-15 ATPARP2 poly(ADP-ribose) polymerase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007882 [exp] 110 / 1e-29 AT4G02390 758 / 0.0 POLY\(ADP-RIBOSE\) POLYMERASE 1, poly(ADP-ribose) polymerase (.1) Lus10030363 [exp] 103 / 2e-27 AT4G02390 571 / 0.0 POLY\(ADP-RIBOSE\) POLYMERASE 1, poly(ADP-ribose) polymerase (.1) Lus10033871 [exp] 64 / 2e-13 AT2G31320 1372 / 0.0 poly(ADP-ribose) polymerase 2 (.1) Lus10019539 [exp] 46 / 4e-07 AT5G22470 957 / 0.0 NAD+ ADP-ribosyltransferases;NAD+ ADP-ribosyltransferases (.1) Lus10043383 [exp] 43 / 4e-06 AT5G22470 1079 / 0.0 NAD+ ADP-ribosyltransferases;NAD+ ADP-ribosyltransferases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G128200 [exp] 140 / 1e-40 AT4G02390 827 / 0.0 POLY\(ADP-RIBOSE\) POLYMERASE 1, poly(ADP-ribose) polymerase (.1) Potri.009G136501 [exp] 85 / 2e-22 AT4G02390 74 / 5e-16 POLY\(ADP-RIBOSE\) POLYMERASE 1, poly(ADP-ribose) polymerase (.1) Potri.014G128000 [exp] 82 / 5e-20 AT4G02390 587 / 0.0 POLY\(ADP-RIBOSE\) POLYMERASE 1, poly(ADP-ribose) polymerase (.1) Potri.002G041300 [exp] 70 / 2e-15 AT2G31320 1382 / 0.0 poly(ADP-ribose) polymerase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0084 [flax] [poplar] ADP-ribosyl PF00644 [flax] [poplar] PARP Poly(ADP-ribose) polymerase catalytic domain
Representative CDS sequence Show only first row Show all	>Lus10000104 pacid=23177875 polypeptide=Lus10000104 locus=Lus10000104.g ID=Lus10000104.BGIv1.0 annot-version=v1.0 ATGGCTGAGCTTTCACAAGCCAAGTATGATGCTGATAAGTTGCCGCCTGGAAAGCTAAGCACAAAAGGTGTAGGTGAAACGGCTCCGGATCTCTCGGAAG CAAAGGCACTTGAAGATGGGGTAGTCGTCCCCTTAGGGAAGCCGAAACAGCAAGGGAGTAAGGGTTCCCTATTGTACAATGAGTACATAGTCTACAACGT GGATCAAATCAGGATGCGATACATCGTCCAAGTGAATTTCTATTTCAAGTAA
AA sequence Show only first row Show all	>Lus10000104 pacid=23177875 polypeptide=Lus10000104 locus=Lus10000104.g ID=Lus10000104.BGIv1.0 annot-version=v1.0 MAELSQAKYDADKLPPGKLSTKGVGETAPDLSEAKALEDGVVVPLGKPKQQGSKGSLLYNEYIVYNVDQIRMRYIVQVNFYFK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02390		ATPARP1, APP	POLY\(ADP-RIBOSE\) POLYMERASE ...		Lus10000104 [exp]	0	1
AT5G28640		ATGIF1, GIF1, A...	ARABIDOPSIS GRF1-INTERACTING F...		Lus10006568 [exp]	8.5	0.8762
AT4G18570			Tetratricopeptide repeat (TPR)...		Lus10015292 [exp]	14.1	0.8561
AT4G37790	HD	HAT22	Homeobox-leucine zipper protei...		Lus10027633 [exp]	14.8	0.7951
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10040853 [exp]	22.3	0.8681
AT3G53730			Histone superfamily protein (....		Lus10038481 [exp]	28.4	0.8677
AT3G56850	bZIP	DPBF3, AREB3	ABA-responsive element binding...		Lus10028889 [exp]	29.6	0.7624
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10021157 [exp]	32.7	0.8667
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10041347 [exp]	38.4	0.8659
AT1G14900		HMGA	high mobility group A (.1)		Lus10002284 [exp]	38.6	0.8658
AT3G27360			Histone superfamily protein (....		Lus10013948 [exp]	45.7	0.8640

Compare expression of checked genes

Lus10000104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.