Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10720 113 / 1e-30 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) AT1G27320 53 / 2e-09 AHK3 histidine kinase 3 (.1) AT5G26594 45 / 4e-07 ARR24 response regulator 24 (.1) AT2G01830 44 / 3e-06 CRE1, AHK4, WOL1, WOL, ATCRE1 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) AT5G35750 44 / 4e-06 AHK2 histidine kinase 2 (.1) AT2G17820 39 / 0.0001 AHK1, ATHK1 histidine kinase 1 (.1) AT2G47430 38 / 0.0003 CKI1 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000137 [exp] 195 / 9e-67 AT5G10720 113 / 1e-30 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Lus10020114 [exp] 185 / 4e-62 AT5G10720 177 / 2e-52 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Lus10026917 [exp] 201 / 1e-61 AT5G10720 1063 / 0.0 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Lus10006370 [exp] 50 / 4e-08 AT5G35750 1267 / 0.0 histidine kinase 2 (.1) Lus10041891 [exp] 49 / 4e-08 AT2G17820 1561 / 0.0 histidine kinase 1 (.1) Lus10012325 [exp] 49 / 9e-08 AT5G35750 1278 / 0.0 histidine kinase 2 (.1) Lus10037032 [exp] 48 / 1e-07 AT1G27320 1094 / 0.0 histidine kinase 3 (.1) Lus10015773 [exp] 48 / 1e-07 AT1G27320 1395 / 0.0 histidine kinase 3 (.1) Lus10028438 [exp] 47 / 3e-07 AT2G17820 1553 / 0.0 histidine kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G270500 [exp] 122 / 9e-34 AT5G10720 725 / 0.0 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Potri.018G011400 [exp] 121 / 2e-33 AT5G10720 707 / 0.0 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Potri.003G171000 [exp] 54 / 1e-09 AT1G27320 1425 / 0.0 histidine kinase 3 (.1) Potri.010G102900 [exp] 54 / 1e-09 AT2G01830 1381 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Potri.008G137900 [exp] 53 / 2e-09 AT2G01830 1390 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Potri.013G009700 [exp] 49 / 6e-08 AT2G47430 572 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Potri.014G121500 [exp] 49 / 8e-08 AT2G47430 753 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Potri.008G191100 [exp] 48 / 1e-07 AT2G47430 746 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Potri.007G056400 [exp] 45 / 1e-06 AT2G17820 1475 / 0.0 histidine kinase 1 (.1) Potri.002G253000 [exp] 44 / 1e-06 AT5G26594 171 / 5e-56 response regulator 24 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [flax] [poplar] CheY PF00072 [flax] [poplar] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Lus10000105 pacid=23174293 polypeptide=Lus10000105 locus=Lus10000105.g ID=Lus10000105.BGIv1.0 annot-version=v1.0 ATGGTAGCTCGATCCATGATGAAGCAGTTAGGGCATGACATAATTGTGGTGAACAATGGAGTCGAAGCAGTGAAGGCGGTACAACGGGAACACTATGATC TCGTTCTAATGGATGTATATATGCCAGTTATGGATGGCCTTCAAGCTACAAGGATAATCCGTTCTTACGAGGAAACAGGAAGTTGGGACGCAGCCGTCGA AGCTGGAATTGAGCAATCAGCCACTTGCTTACAAAATGGGCATAGCTTCCATCCCAGTTCCAGAGATCATATCCCCATAGTCGCGGTAAGTTAG
AA sequence Show only first row Show all	>Lus10000105 pacid=23174293 polypeptide=Lus10000105 locus=Lus10000105.g ID=Lus10000105.BGIv1.0 annot-version=v1.0 MVARSMMKQLGHDIIVVNNGVEAVKAVQREHYDLVLMDVYMPVMDGLQATRIIRSYEETGSWDAAVEAGIEQSATCLQNGHSFHPSSRDHIPIVAVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10000105 [exp]	0	1
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10026917 [exp]	2.4	0.8985
AT5G14000	NAC	ANAC084	NAC domain containing protein ...		Lus10012557 [exp]	4.5	0.9059
AT2G02061			Nucleotide-diphospho-sugar tra...		Lus10031330 [exp]	6.6	0.9058
					Lus10033509 [exp]	8.9	0.8944
AT2G17080			Arabidopsis protein of unknown...		Lus10023959 [exp]	9.4	0.8711
AT1G77660			Histone H3 K4-specific methylt...		Lus10028062 [exp]	11.3	0.8503
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Lus10028719 [exp]	11.4	0.8852
AT3G53570		AME2, AFC1	FUS3-complementing gene 1 (.1....		Lus10024431 [exp]	12.3	0.8600
AT5G14020			Endosomal targeting BRO1-like ...		Lus10035167 [exp]	14.5	0.8838
AT1G68920	bHLH	bHLH049, ACE1	basic helix-loop-helix (bHLH) ...		Lus10029110 [exp]	16.0	0.8662

Compare expression of checked genes

Lus10000105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.