Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20350 68 / 1e-14 TIP1 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT2G14255 64 / 2e-13 Ankyrin repeat family protein with DHHC zinc finger domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020505 [exp] 86 / 4e-21 AT2G14255 389 / 2e-131 Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10012455 [exp] 84 / 3e-20 AT2G14255 597 / 0.0 Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10008037 [exp] 66 / 8e-14 AT5G20350 905 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10038108 [exp] 64 / 5e-13 AT5G20350 839 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G287000 [exp] 69 / 8e-15 AT2G14255 671 / 0.0 Ankyrin repeat family protein with DHHC zinc finger domain (.1) Potri.006G061800 [exp] 64 / 4e-13 AT5G20350 959 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Potri.018G121200 [exp] 64 / 5e-13 AT5G20350 951 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000132 pacid=23173068 polypeptide=Lus10000132 locus=Lus10000132.g ID=Lus10000132.BGIv1.0 annot-version=v1.0 ATGTCCTCTAAGAAGTTTCGGATGAAGTGGAGGAGTCTTGTGCAGAACACATTTATGTTTGCTATGAAGGAACGAGTTTCTGAGGCAGTTCATGTTGCTG CTCAATATGGACAAACTGCTTTCTTGAATCACATTGTGGTGAACCATCATGCTGATTTCGATGCACCTGACAACGATGGGAGGAGCCCTCTTCATTGGTA TGTAACGTCCTGGGGTTTATCCGTTAATACTTCTTGGGTGCCATCTTTGTTATGTATTGTCCAGCGCATTGTCTCTTCAATGTTTGCCATTAGTAAGGGA GACAACTAG
AA sequence Show only first row Show all	>Lus10000132 pacid=23173068 polypeptide=Lus10000132 locus=Lus10000132.g ID=Lus10000132.BGIv1.0 annot-version=v1.0 MSSKKFRMKWRSLVQNTFMFAMKERVSEAVHVAAQYGQTAFLNHIVVNHHADFDAPDNDGRSPLHWYVTSWGLSVNTSWVPSLLCIVQRIVSSMFAISKG DN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14255			Ankyrin repeat family protein ...		Lus10000132 [exp]	0	1
AT5G22450			unknown protein		Lus10004878 [exp]	16.1	0.7632
AT1G17500			ATPase E1-E2 type family prote...		Lus10008473 [exp]	21.7	0.7476
AT5G06120			ARM repeat superfamily protein...		Lus10041603 [exp]	23.3	0.7561
AT3G63340			Protein phosphatase 2C family ...		Lus10000491 [exp]	40.0	0.7364
AT4G19110			Protein kinase superfamily pro...		Lus10005183 [exp]	46.3	0.7093
AT3G56830			Protein of unknown function (D...		Lus10030290 [exp]	47.9	0.7142
					Lus10031222 [exp]	65.8	0.6661
AT3G20720			unknown protein		Lus10011166 [exp]	77.8	0.6982
					Lus10023643 [exp]	79.6	0.6907
					Lus10019222 [exp]	84.6	0.6238

Compare expression of checked genes

Lus10000132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.